KEGG   Rhodococcus fascians: A3L23_01552Help
Entry
A3L23_01552       CDS       T04328                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rfa  Rhodococcus fascians
Pathway
rfa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rfa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    A3L23_01552
Enzymes [BR:rfa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     A3L23_01552
DNA repair and recombination proteins [BR:rfa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     A3L23_01552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AMY52902
UniProt: A0A161GHX6
LinkDB All DBs
Position
1652354..1654660
Genome map
AA seq 768 aa AA seqDB search
MATLEIEGRKVSVTNLDKVLFPETSTTKSDIIEYYAAIAPAMLPHVAGRAVTRKRWPNGV
EQSSFFEKNLAASAPDWLDRRSMQHSDRVVTYPLFSTAADLVWLGQQAAIEAHVPQWRFD
GTEPGPATRMVFDLDPGDDVDLARCAEVACEIRDLIADIGMTAYPVTSGSKGIHLYVPLD
KPLSTSGASTVAKRVATLLEERSPDRVTATMAKAKRTGRVFVDWSQNNGKKTTVAPYSLR
GRSLPTVAAPRTWEELESPGLQQLRFEEVLERFHDTGDLLADLDPKPAAEEHDTSDTDKL
GKYRSMRSADRTPEPIPKTAEPQGNDDTFVIQEHHARRLHYDFRLEHDGVLVSWAVPKNI
PVETGQNRLAVHTEDHPLEYATFSGRIPKGEYGGGDVSIWDSGTYELEKWRDDEVIVVLH
GAKARGRFALIRTKGNQWLMHLMKDQPGEHSTKKDNPSTGKPVLRNISPMLATAGDILDL
PEDEWSFEGKWDGFRIVAELTHGSMTLRTRSGNDYTEKFGAIGSLAEDLADHDAVIDGEV
VVFDSNGISSFEKLQNAARDDIRFIAFDLLHLDGTSLVRKKYSDRRRLLELLTTGLDSVL
VPPLLTGSAADAIAESRERGWEGVVAKRTDSIYQPGKRAHTWIKYKNWRTQEVVIGGWRR
GQGRRSGGFGSLLMGIPDGDGLRYVGRVGTGFDDRALDSLAGLLSPLETSDSPFSTTLPT
ADRRGAVWVEPVLVGEVRFYEATESGHLRHPSWRGLRPDKTPADVVPE
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggccacgctcgagatcgaaggccgaaaggtctccgtcaccaacctcgacaaggtgctg
ttcccagaaaccagcaccaccaaaagcgacatcatcgagtactacgctgccatcgccccg
gcgatgctgccgcacgtcgcaggacgcgccgtgacccgcaagcgatggccgaacggcgtc
gaacaatcctcgttcttcgagaagaatctcgccgcatccgcacccgactggctcgaccgc
cgatccatgcagcactccgaccgagtcgtcacctacccgttgttctccaccgcagcggat
ctggtgtggctcgggcagcaggcggccatcgaagcgcacgtgccgcaatggcgtttcgac
ggcaccgaacccggccctgccacccgcatggtcttcgacctagatcccggcgacgacgtc
gacctcgcccgatgcgctgaggtggcctgcgagatccgtgacctcattgcagacatcggc
atgaccgcgtacccggtcaccagcggcagcaagggaattcacctgtacgtaccgctggac
aaaccgctgtcgacgtccggcgcatccaccgtcgccaaacgcgtcgccaccctgctcgaa
gaacggtcaccggatcgggtgaccgccacgatggcgaaagcgaagcgcacgggtcgagtg
ttcgtcgattggagtcagaacaacggaaagaagacaaccgttgcgccgtactcacttcgg
ggccgatccctacccaccgtcgcggccccccgaacctgggaggagctcgaatcgccaggg
ctgcaacaacttcgattcgaggaagttctggaacggttccacgacaccggcgacctattg
gccgatctcgacccgaaaccggcagcggaagagcacgacacctccgacacggacaagctc
ggcaagtaccgcagcatgcgtagcgcggaccgaactccagagcctatcccgaaaaccgcc
gagccccagggtaacgacgatacgttcgtgattcaggaacaccatgcgcgacgcctgcac
tacgacttcaggctcgaacacgacggtgtcctggtgtcgtgggccgtacccaagaacatc
ccggtcgagaccgggcagaaccgtctcgcagtccacaccgaggaccacccgctggaatat
gcgacgttctccggacgaatccccaagggcgagtacggcggcggtgacgtctcgatctgg
gacagcggaacctacgaactcgagaagtggagagacgacgaagtcatcgtcgttctgcac
ggagccaaagcacgcggcaggttcgccctcatccgcaccaagggcaaccagtggctcatg
cacctgatgaaggaccaacccggagagcactcgacgaaaaaggacaacccgtcgacggga
aagccggtgctgagaaacatctcaccgatgctcgcaacagcaggcgacatactcgaccta
cccgaggacgaatggtcgttcgagggtaaatgggacggcttccgtatcgtcgccgaactg
actcacggttcgatgaccctgcgcacccgaagcggaaacgactacaccgagaagttcgga
gccatcgggtctctcgccgaggacctggccgatcacgacgccgtcatcgacggtgaagtg
gtcgtcttcgacagcaacggcatcagcagcttcgagaagctacagaacgccgcccgcgac
gacatccggttcatcgccttcgacctgctccatctcgacggcacgtccctcgtgcgcaag
aagtactccgaccggagacgattgttggaattgctcaccaccggcctcgactcggttctg
gtgccgccgttgctgacgggttcggctgccgacgccatcgccgagagccgtgagcggggg
tgggagggagtcgtcgccaagcgcaccgattcgatctatcagccgggcaagcgcgcccac
acctggatcaagtacaagaactggcgcacgcaagaagtcgtgatcggcggttggcgacgc
ggccaggggcgtcgttccggcggattcggctcactgctgatggggatccccgacggcgac
ggtcttcgctacgtcggtcgcgtcggcaccggtttcgacgatcgcgcgctcgattcactc
gccggtctgctctctccgttggaaacgtcggacagtcctttctccacgacgcttcccact
gccgacagacgcggtgccgtatgggtggagcctgttctcgtcggagaagtgcggttctac
gaggccaccgaatccggccatctgcgtcacccgagctggcgcggactgcgcccggacaag
acgccggcggacgtcgttcccgagtag

DBGET integrated database retrieval system