KEGG   Rhodococcus fascians: A3L23_03747Help
Entry
A3L23_03747       CDS       T04328                                 

Gene name
davT
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rfa  Rhodococcus fascians
Pathway
rfa00250  Alanine, aspartate and glutamate metabolism
rfa00410  beta-Alanine metabolism
rfa00640  Propanoate metabolism
rfa00650  Butanoate metabolism
rfa01100  Metabolic pathways
rfa01120  Microbial metabolism in diverse environments
Module
rfa_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rfa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A3L23_03747 (davT)
   00650 Butanoate metabolism
    A3L23_03747 (davT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A3L23_03747 (davT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A3L23_03747 (davT)
Enzymes [BR:rfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A3L23_03747 (davT)
Amino acid related enzymes [BR:rfa01007]
 Aminotransferase (transaminase)
  Class III
   A3L23_03747 (davT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMY55063
UniProt: A0A165MK09
LinkDB All DBs
Position
3920955..3922229
Genome map
AA seq 424 aa AA seqDB search
MASMTASTRTHLSPALKQATPIVVDHGKGSWIIGTDGRKYLDFTTGIGVTSTGHCHPRVV
EAAREQVGKIIHAQYTTVMHQPLLALTDKLGEVLPAGLDSVFYANSGSEAVEASIRLARM
ATGRPNIVAFHGGFHGRTVAAASLTTAGTKFRSGFSPIMGGVHIAPFPYAFRYGWDMDTA
VAFALKELDYLLVTMSSPADTAAFIIEPVLGDGGYLPTPPAFLEGLRERADTHGIVLIVD
EVQAGVGRTGTFWGHQHSSITPDILITAKGLASGFPISAIAASAELMGKAWPGSQGGTYG
GNAVAAAAGVATLDVVREEGLVDNAAAQGRVLLDGLLALKEQHPAIGDARGLGLMQALEF
VDSSGNPDAAAALRVQQGAIDEGLLLLTCGALGNVVRIIPALIVNDDEMTFGLDALSRTL
KNVL
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatgacagcgtcgactcgcacccacctcagccccgcactcaagcaggcgacc
ccgatcgtcgtcgaccacggaaagggcagctggatcatcgggaccgacgggcgcaagtac
ctcgacttcaccaccggcatcggcgtcaccagcaccggtcactgccatccccgcgtggtc
gaggcagctcgcgaacaggtgggcaagatcatccacgcccagtacacgaccgtcatgcat
cagcctctgctcgcgctgacggacaagctcggagaagtgttgcctgccgggttggacagt
gtgttctacgcgaactcgggatccgaggcagtcgaggcgtcgatccgattggcgcgcatg
gcaaccggtcgaccgaacatcgttgcattccacggcggcttccacgggcgaacggtggcg
gctgcatcgctcaccacggcgggaaccaagttccgatcgggattctcgccgatcatgggt
ggggtgcacatcgcaccgtttccgtatgcatttcggtacggatgggacatggacaccgca
gtcgcctttgcgctgaaggagctcgactacctgttggtgacgatgtccagccccgccgac
acggctgcgttcatcatcgagccggtgctgggcgacggcggatacctgcccacaccccct
gcattcctcgagggcttgcgcgaacgcgccgacacccacggcatcgtcctgatcgtcgac
gaggtgcaggccggagtcggacgcaccggaacgttctggggccatcagcactcgtcgatc
actcccgacatcctcatcaccgcaaaaggactcgccagcgggttcccgatctcggcgatc
gccgcatcggcagagctgatggggaaggcatggccggggtcgcaaggcggaacctacggc
ggcaacgccgtcgctgccgcggcgggagtcgctaccctcgacgtcgtgcgcgaggaaggt
ctggtcgacaacgcggcagcgcagggccgagttctcctcgacggcctactcgcgctgaag
gaacagcacccggccatcggtgatgctcggggactcggattgatgcaggcgctcgaattc
gtcgacagctcgggcaatcccgacgccgccgctgctctgcgggtgcaacagggtgccatc
gacgaagggctgctgttgctcacctgcggtgcgctcggcaacgtggttcgtatcatcccc
gcactgatcgtgaacgacgacgagatgacgttcggactcgacgcgttgtcgcggacattg
aagaacgtcctgtga

DBGET integrated database retrieval system