KEGG   Rhodoferax ferrireducens: Rfer_2145Help
Entry
Rfer_2145         CDS       T00334                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
Organism
rfr  Rhodoferax ferrireducens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2326892..2329768)
Genome map
AA seq 958 aa AA seqDB search
MSMSDEQTSSETKRSAPLGGRGIACTLDSESLAPRLLATVRSVADELRPQARLAATLGLD
DSLERDYGLDSLARVELIARLDRDLGVSLGEAAITQAETPRDLLRFITPVSGRGAAPARA
PQALTSREAVSDDYPPDSVQTLVDVFEWHLQHHPDRVLITLYENGDQAVDLRYAELHREA
VALAAGLRALGLDKGDKVAIMLPTGREFFAAFFGTLYAGLVPVPLYPPARPSQLEDHLKR
IAAIVRNAQARVLVTVERAKPLSQLLRAQAEALQFVRTVADLSLADAPRMQPALTASDIA
FLQYTSGSTGDPKGVILTHANLLANLRAMWRASQVGSSDTFVSWLPLYHDMGLIGACLGA
LYLGFHLVLMSPLAFLARPARWLETIHRHRGTVSAAPNFAYELCLSKLTDAELAGLDLSC
WRLAFNGAEPVSPDTLERFAARFAPCSFKREALTPVYGLAENTVGLAFGPVGRGPLVDRV
DRAALARDGVAEPARPDDAQALRIVSCGSPLPGHELRVVGAGGRELPEREQGRVQFRGPS
STQGYLNNPVANQRLLDGDWLNTGDLGYIAAAELFLTGREKDIIIRGGFNIHPQELESAV
ANIAGVRKGGVAVFAATDRRSGTERLVVLAETRVREPAQRAQMIRAITALSATLLGAPAD
DVVLAPPRSVLKTSSGKTRRAACRELYEQGRLGTTQRPPWQQWAALAATAAAARVRRAIR
TTGRLVWGLWAWAVFCTLAALAWGAVMVLPGVARRRRVTRALTRLLIRLIGLPLRVEGLA
RLPAAGPRIVVANHASYVDSMLLGAVLPPEFSFAAKRELADAALIGPALRRLGIAFVERV
DAAQGIEDTKALQARVRAGESMVFFPEGRLRRASGLQPFKLGAFVIAAETATPVVPVALN
GTRSLLRDGAWLPLRCAIQLTIGEAIPATGPGWSRALELRDAARKALAAHLAEATHDV
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatgagcgatgaacaaacctccagcgaaacaaaacgatcggccccccttgggggg
cgcgggattgcctgtacgctggattccgagtcgctggcaccgcgcttgctggcgacggtg
cgcagcgtggccgacgagttgcggccacaggcgcggctcgccgccaccctgggattggac
gattcactggagcgcgactacggcctggacagcctggcccgtgtcgagctgatcgcccgc
ctcgaccgcgatcttggcgtgtcgctgggtgaggcggcgatcacgcaggcggagacgccg
cgcgacctgttgcgtttcatcacacccgtcagtgggcgcggtgccgcaccggcgcgcgca
ccacaggcgctcacgtcgcgagaggcggtgagtgacgactatccgccggactcggtccag
acgctggtggatgttttcgaatggcacctgcagcaccaccccgaccgcgtgctcatcacc
ctgtacgagaacggtgaccaggccgtcgatctgcgctacgccgaattgcaccgcgaggcg
gtcgcgctggctgcgggcttgcgcgcgctcgggctggacaagggcgacaaggtggcgatc
atgctgcccaccgggcgcgagttctttgccgcgttctttggcacgctgtatgcagggctg
gtgccggtgccgctgtacccgccggcacggccgtcgcagcttgaggaccacctgaaacgg
atcgcggccattgtgcgcaatgcccaggcgcgggtgctggtgaccgtcgagcgtgccaag
ccgctgtcgcagctgttgcgggcccaggccgaagccctgcagttcgtccgcacggtggcc
gacctgtcgctggcggacgcccccaggatgcagcccgcgctcacggcatcggacatcgcg
ttcctgcagtacacctcgggcagcaccggcgatcccaagggggtgatcctgacgcacgcc
aacctgctggccaacctgcgcgcgatgtggcgggcctcgcaggtcggcagcagcgacacc
ttcgtctcctggctgccgctgtaccacgacatggggctgatcggtgcctgcctgggcgcc
ctgtacctgggctttcatctggtgctgatgtcgccgctggcgtttctcgcccgaccggcg
cgctggctggagaccatccaccgccatcgtggcacggtgtcggcggcacccaacttcgcg
tacgagctgtgcctgtccaaactgacggacgctgaactggctggactggacctgtcctgc
tggcggctggcgttcaacggggccgagccggtgagtcccgatacgctggaacgctttgcg
gcgcggttcgcgccttgcagtttcaagcgcgaggcgctcacgccggtgtacggcctggcc
gaaaacacggttggcctggcctttgggccggtgggccgcggcccgctggtggatcgcgtc
gatcgggccgcgctcgcccgcgacggcgtggcggagccggcgcggcccgacgacgcgcaa
gcgctgcgcatcgtctcctgtggctcgccgctgcccggtcacgaactgcgcgtggtcggc
gccggcgggcgcgaattgcccgagcgtgagcaggggcgcgtgcagttccgcggcccgtcc
agcacccagggctacctgaacaatccggttgccaatcagcgcctgctcgacggcgactgg
ctcaacaccggcgacctcggctacatcgcagccgcagaactgttcctcaccgggcgcgag
aaggacatcatcatccgcggtggcttcaacatccacccgcaggagctcgaaagcgcggtg
gccaacatcgccggcgtgcgcaaggggggcgtggcggtgttcgcggcgaccgatcgtcgc
agcggcaccgaacggctggtggtgctcgccgagacccgggtccgtgagccggcgcaacgt
gcgcaaatgatccgggccatcaccgccctgtcggccacgctgctgggcgcgccggccgac
gacgtggtgctggcgccgccacgctcggtattgaagacgtccagcggcaagacccgccgc
gccgcctgccgcgagttgtacgagcagggccggctcggcacgacgcagcgcccgccctgg
cagcaatgggcggccttggccgcgacggcggcggcggcgcgggttcgccgcgcgatccgc
acaacaggccgactggtctgggggctgtgggcctgggccgtgttctgcacgctggcggca
ctggcgtggggtgcggtaatggtgttgcccggcgtggcccggcgccgacgggtcacgcgc
gcgctgacgcgcttgctgatccggctgatcggcctgccgctgcgggtcgaggggctggcg
cggctgccggcggcggggccgcgcatcgtggtggccaaccacgccagctatgtcgattcg
atgctgttgggtgccgtgctgccgcccgagttctccttcgccgccaagcgcgagctggcc
gacgcggcgctgatcggcccggcgctgcgccggctagggattgccttcgtcgagcgcgtg
gacgcggcgcaggggatcgaggacaccaaggcgctgcaagcgcgtgtgcgtgccggcgaa
tcgatggtgttcttccccgaaggccggctgcggcgggccagtggcctgcagcctttcaag
ctcggggccttcgtcatcgccgccgaaacggcgacgccggtggtgccggtggcgctcaac
ggcacccgctcgctgctgcgcgatggggcctggctgccgctgcgctgcgctattcagttg
acgattggcgaggcgatccctgcgacgggtccaggctggagccgcgcgcttgaactgcgc
gatgcggcgcgcaaagcgctggccgcccatctggcggaggcgacgcacgatgtttga

DBGET integrated database retrieval system