KEGG   Rhodoferax ferrireducens: Rfer_2160Help
Entry
Rfer_2160         CDS       T00334                                 

Definition
(GenBank) Trehalose synthase-like
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rfr  Rhodoferax ferrireducens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rfr00001]
   00500 Starch and sucrose metabolism
    Rfer_2160
Enzymes [BR:rfr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Rfer_2160
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Rfer_2160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(2349969..2353307)
Genome map
AA seq 1112 aa AA seqDB search
MNAPATNLTLETVEIDGRDDPLWYRDAVIYQLNVKAFFDSNDDGMGDFKGVAIKLDYVRD
LGVNTIWLMPFYPSPMRDDGYDIAEYEDVHPQYGSLDDFREMLAEAHKRDLRVIIELVMN
HTSSDHPWFQAARRSPPGSPEREFYVWSDSDQLYKDTRIIFTDTETSNWTWDPVAKAFFW
HRFFSHQPDLNFDNPKVLEAIFKTMRFWLDMGVDGFRLDAIPYLVERDGTSNENLPETHA
VIKQLRAAIDAQYKNRFLLAEANMWPEDVREYFGDGDECHMAYHFPLMPRMYMAIAQEDR
HPIIEIMQQTPEIPDGCQWAIFLRNHDELTLEMVTSKERDYMYRMYATDPRARINLGIRR
RLAPLMENDADRIKLMNAMLLSMPGSPIIYYGDEIGMGDNMFVGDRNGVRTPMQWSPDRN
AGFSRADPQRLYLQPIMDPMYGYEALNVEAQARDISSLLNWTKRMLAVRKSSRAFGRGKR
SFLKPGNRKILAYLSTYEDDTILAVFNLSRAAQPVELELSVYKGRVPVEMLGRTSFPPIG
ELPYPLTLPSFGFFWFRLAADAEVPSWHQEHVALQDRPTLVLFDGWTSFFRDRVMPWRIG
MADRMRTQFETDTLPRHIEIQRWYASKGTPIERARLVDHAVWEAGNFSWMLPILKLDGPV
GESTYFMPLALAWEERDEERIANLAPAALAKVRQQANVGIMGDAFYDPAFCRALVQAIGA
DMEIATAAGRLQFKPTTVFKNFTSDIAALTVSRPSTTSSNTVVTLDDTLFLKGYRRLRQG
LNPELEMGRFLTEVVHFPNCVPVLGALEYFMSDGNVMTLALVQGYVANQGDGWDYTSRYV
ERFLEELRISGEANATAGETHGGFLAFAATLGQRTAELHLALTQHTAEPAFDPEPLLSRD
VIAFKDRAAREATATLSLLRERQAQLPAAAQEVAQALLLQQDRLQTRIAAVKTEGKVSIK
TRYHGDYHLGQVLVTGNDFVIIDFEGEPARSFEERRTKSSPLRDVAGMLRSFNYAHWSAL
RRVAQNTAEIDQLEPAVREWERSTREAFLAAYEHVMMSVELAQPVDLDLLALFELEKALY
ELRYELNNRIDWIQVPLQGILALIDPDTGLTR
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacctgcaaccaatctgacgctcgaaactgtcgagattgatggccgcgacgat
ccgctgtggtatcgcgacgcggtcatctaccagctcaacgtcaaagcgttcttcgacagc
aacgacgacggtatgggtgacttcaagggtgtcgcaatcaagctcgactatgtccgggac
ctgggggtcaacaccatctggctgatgcccttctatccctcgccgatgcgcgacgacggc
tacgacattgcggaatatgaagacgttcacccacaatacggctcgctcgacgactttcgt
gaaatgctggccgaggcgcacaagcgcgacttgcgggtgatcatagagctcgtcatgaat
cacacatcaagcgatcacccgtggttccaggcagcgcgacgctcgccaccgggctcgccc
gagcgcgagttctatgtctggagcgatagcgatcagctgtacaaagacacgcgcatcatc
ttcaccgataccgagacctccaactggacctgggacccggtggccaaggccttcttctgg
caccgcttcttcagtcatcagcctgatctgaatttcgacaatcccaaagtgctcgaagca
atcttcaagaccatgcgattctggctcgacatgggcgttgacggtttccgcctcgacgcc
attccctacctcgtcgagcgtgatggcaccagcaacgagaacctgccggagacgcacgcg
gtgatcaaacagctgcgcgcggccatcgacgcgcaatacaagaaccgcttcctgctggct
gaagccaatatgtggcccgaggacgttcgagaatacttcggcgacggcgacgagtgccac
atggcctaccacttcccgctgatgccgcgcatgtacatggccatcgctcaggaagaccgt
cacccgattatcgaaatcatgcagcaaacgccggaaattcccgacggctgccagtgggcc
atctttctgcgcaaccacgatgaactgaccctggaaatggtgaccagcaaggaacgggac
tacatgtaccgcatgtatgcgactgacccgcgggcccggatcaacctgggtattcgccgc
cgcctcgccccgctgatggagaacgacgcggatcgcatcaagctgatgaacgcaatgctg
ctgtcgatgcccggctcgcccatcatctactacggtgacgagatcggcatgggcgacaac
atgttcgtcggcgaccgcaacggcgtgcgtacaccgatgcagtggagccccgaccgcaac
gccggtttctcccgtgccgacccgcaacgcctgtacctgcaacccatcatggatccgatg
tacggttacgaggccctcaacgtcgaggcccaggcgcgcgacatcagctcgctgctcaac
tggaccaaacggatgctcgccgtgcgcaaaagcagccgggccttcggccgcggcaaacgc
agcttcctcaagcctggcaaccgcaagatcctggcgtacctgagcacgtacgaggacgac
accatcctggcagtgttcaatctgtcacgcgcggcgcagccggtggagctggagctgtcg
gtctacaagggccgcgtgccggtcgagatgctgggacgcacctccttcccgccgattggc
gagctgccctatccgctgacgctgccgtcattcggtttcttctggttccggctcgccgcc
gacgctgaagttccgagctggcatcaggagcatgtggcactgcaagaccgcccgacgctg
gtgctgtttgatggctggaccagcttctttcgcgatcgcgtgatgccgtggcgaatcgga
atggccgaccgcatgcgcacgcaattcgaaactgacacgctgccgcgtcatattgagatc
cagcgttggtacgcctccaaaggcacgcccattgaacgcgcacggctggtcgatcatgca
gtgtgggaggccggcaacttcagctggatgctgcccattctgaaactggacggacccgtc
ggggaatcgacctatttcatgccgctggcactggcgtgggaggagcgcgacgaagagcgc
atcgccaacctcgcgcccgctgcgctggccaaggtacgccagcaggccaacgttggcatc
atgggcgatgctttctacgacccggccttctgccgcgccttggtccaggcgatcggcgcc
gacatggaaattgccactgcggccggacgtctgcagttcaaacccacgacggtgttcaaa
aactttacctcagacatcgccgcgctaacggtatcgcgtccgagcacgacgagcagcaac
acggttgtgacactggatgacacgctttttctcaagggttaccgtcgtctgcgccagggc
ctgaatcccgaactggagatgggtcgcttcctgactgaagtcgtacacttcccgaactgc
gttccggtgctgggcgcactcgaatacttcatgagcgatggcaacgtcatgacgctggcc
ctggtccagggttacgtggccaaccaaggggacggctgggactacacatcacgttacgtc
gagcgcttcctggaagagctgcgcatctcgggcgaagccaatgccaccgcaggcgaaaca
catggcggctttctggcttttgccgccacacttggccagcgcactgcggagcttcacctc
gcactgacgcaacacacagcagagccagccttcgaccccgaacctctcttgtcgagagat
gtcatcgcgttcaaggaccgggcggctagagaggccaccgccacattgtcactgctgcgc
gagcgccaggcgcaattgcccgcagccgcccaagaggtagcccaagccctgctgttgcaa
caggaccgcctgcagactcgcatcgccgccgtcaagaccgaggggaaagtcagcatcaaa
acacgctaccacggcgactaccatttgggccaggtcctcgtaaccggcaacgatttcgtg
attatcgacttcgagggtgagccagcccgcagctttgaagaacgccgcaccaagagttca
cctttgcgcgacgtggcgggcatgctgcggtctttcaattatgcacactggtcagcgctg
cggcgcgtggcacaaaatactgccgagattgaccaactggaacccgcagtgcgcgaatgg
gagcgcagcacccgcgaggctttcctggcggcctacgagcacgtcatgatgtcggtcgaa
ttggcgcagccagttgacctggacctgctcgcattgttcgaactggaaaaggcactttac
gaactccgatacgagctcaataatcgcatcgactggatccaggtgcctttgcaaggtatc
ctggccctgattgatcctgatacgggcctgacacgctga

DBGET integrated database retrieval system