KEGG   Rhizobium gallicum: RGR602_CH01328Help
Entry
RGR602_CH01328    CDS       T03539                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rga  Rhizobium gallicum
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rga00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    RGR602_CH01328 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    RGR602_CH01328 (alr)
Enzymes [BR:rga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     RGR602_CH01328 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rga01011]
 Precursor biosynthesis
  Racemase
   RGR602_CH01328 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1342298..1343458)
Genome map
AA seq 386 aa AA seqDB search
MTEISAASEEDRFASAGMRLIVDLTALTENWRDMARRSKRARASAVVKADAYGMGIEDAG
EALYIAGARDFFVATVDEGVTLRLYAPDARIFVLAGIWPGTERRFFENDLVPVISSEEQL
AFWMAVLSEYGDYPCALHVDTGFNRLGLHIDEALALADDVSRPASFAPVLVMSHLACGDD
PSSQMNKQQLESFRKVSAAYEGIESSLAASGGIFLGEDYHFDLTRPGIAIYGGEAVSGMA
NPMRPVATAQARVIQVRTVRAGESVSYGRTLRLDRDSRLAVVSAGYADGYMRSQSSGGIP
LRQAVPQGGQGFFEGYTVPVAGRITMDLSIFDVTDLPENLIRAGDYIELFGRNIPVDDAA
RAAGTIGYEMLAGVGLRYERKYVSEE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatttccgccgcctccgaagaagacaggtttgcttccgccggcatgcggctg
attgtcgacctgactgcgctgacggaaaactggcgggacatggcacggcgctccaaaagg
gcgcgcgcatccgcggtggtgaaggccgacgcctatggcatgggcatcgaggacgctggg
gaagcgctctacatcgcgggcgcccgcgacttcttcgtcgcaacggtcgatgaaggcgtg
acgctgcgcctctacgcgcccgatgcgcgcatcttcgtgctcgccggcatctggccaggc
actgaacgacgcttctttgaaaacgacctcgtgccggtcatctcctccgaggagcagctc
gccttttggatggcggtgctatcggagtatggcgattacccttgcgcgctgcatgtcgat
accggcttcaaccggctcggccttcatatcgacgaagcgcttgcgctggctgatgacgtc
tcccgcccggccagcttcgccccggttctggtcatgagccatctcgcctgcggcgacgat
ccttcatcgcagatgaacaagcagcagctcgaatcattccgcaaggttagcgccgcatat
gaaggtatcgaatcaagcctcgcagcatccggcggcatctttctcggcgaggattatcat
ttcgacctgacgcgccccggcattgccatctacggcggcgaagcggtgagcggcatggcg
aaccccatgcggccggttgcgaccgcgcaggcccgcgtgatccaggtccgcaccgtgcgc
gctggcgaatccgtgagttacggccggacgctgaggcttgaccgcgatagccgcctcgcc
gtcgtttccgccggttatgccgacggctacatgcgcagccagtcgagcggcggcatcccg
cttcgccaagccgtgccgcagggcggccaaggcttctttgagggctacaccgtgccggtc
gccgggcgcatcaccatggacctttccatcttcgatgtgaccgacctaccggaaaacctc
attcgtgccggcgattacatcgagctcttcggcaggaacatccccgttgacgatgcggca
cgggcggcaggcacgatcggctacgagatgctggcaggcgtcgggttgcggtatgagcga
aaatacgtcagcgaagaatga

DBGET integrated database retrieval system