KEGG   Rhizobium gallicum: RGR602_PC01796Help
Entry
RGR602_PC01796    CDS       T03539                                 

Definition
(GenBank) glutathione S-transferase protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rga  Rhizobium gallicum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rga00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RGR602_PC01796
Enzymes [BR:rga01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RGR602_PC01796
Transporters [BR:rga02000]
 Other Transporters
  Pores ion channels [TC:1]
   RGR602_PC01796
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
pRgalR602c:1878486..1879118
Genome map
AA seq 210 aa AA seqDB search
MMKLYGLGPTRSLRALWALQELDAEFEFVPVNLLAGENRRPDFLRLNPAGKLPVLVDGDL
VLTESAAIVMYLAEKYDAKELMPADLRERARAYRWSMFAVTELEQPLWRIAKHAFIYPED
KRLPQDIALAREEFMAMAAILERHMDGREFIVGDKITIADCVTAYVVDWGNENGLVDGCP
NLKAYLERMYARPKAPQRIAEALANLQPVA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactatatggattaggtccgacgcgctcgcttcgcgcactttgggcccttcaa
gagctcgacgcggaattcgagtttgttcccgtcaacctcctggctggcgaaaaccgtcgc
cccgacttcctgcgcctcaatcccgccggaaaactcccggtgctggttgacggtgacctt
gtacttacagaatccgccgcgatcgtcatgtatttagcagaaaagtatgacgccaaagag
ctcatgcccgccgacttaagggaacgggcgcgggcgtaccgctggtctatgtttgcggtc
accgaacttgaacagccgctgtggcggatcgccaagcacgcctttatataccccgaagac
aaacgactgccgcaagacatagctctcgccagagaggagtttatggcgatggcggcaata
cttgagcgtcacatggatgggcgtgagttcatcgtcggcgataaaattaccatcgctgat
tgcgtcaccgcctatgttgtcgattggggcaatgaaaatgggctggttgacggctgtcca
aatctcaaagcctatcttgagcggatgtacgcgcgccccaaggcgccgcagcgcatcgcc
gaagccctcgcaaacctccaacctgttgcctga

DBGET integrated database retrieval system