KEGG   Rubrivivax gelatinosus: RGE_31820Help
Entry
RGE_31820         CDS       T01803                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase [NADP] Icd
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rge  Rubrivivax gelatinosus
Pathway
rge00020  Citrate cycle (TCA cycle)
rge00480  Glutathione metabolism
rge01100  Metabolic pathways
rge01110  Biosynthesis of secondary metabolites
rge01120  Microbial metabolism in diverse environments
rge01130  Biosynthesis of antibiotics
rge01200  Carbon metabolism
rge01210  2-Oxocarboxylic acid metabolism
rge01230  Biosynthesis of amino acids
Module
rge_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rge_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rge00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RGE_31820 (icd)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RGE_31820 (icd)
Enzymes [BR:rge01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     RGE_31820 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: BAL96521
UniProt: I0HU34
LinkDB All DBs
Position
complement(3394865..3396121)
Genome map
AA seq 418 aa AA seqDB search
MYQHIKVPEGGQKITVNADFSLNVPDQPIIPYIEGDGTGFDITPVMLKVVDAAVAKSYGG
KRKIHWMEVYAGEKSTKVYGPDVWLPEETLHAVRDYVVSIKGPLTTPVGGGIRSLNVALR
QELDLYVCLRPIQYFKGVPTPLKEPEKTNMVIFRENSEDIYAGIEWEAKSEKAQKVIKFL
IEEMGVKKIRFPETSGIGIKPVSQEGTERLVRKAIQYAVDNDKPSVTIVHKGNIMKFTEG
GFRDWAYALAQREFGAQPIDGGPWCSFKNPKTGKDIVIKDSIADAFLQQILLRPAEYSVI
ATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILS
AEMMLRHMGWTEAADLIISAMEKSILSKQVTYDFARLMDGATQVSCSGFGKVMIEQMG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagcacatcaaggtgcccgagggcgggcagaagatcacggtcaacgccgacttc
tcgctgaacgtccccgaccagcccatcattccgtacatcgagggcgacggcaccggtttc
gacatcacgccggtgatgttgaaggtggtcgatgcggcggtcgccaagagctacggcggc
aagcgcaagatccactggatggaggtctacgccggcgagaagtcgaccaaggtctacggc
cccgacgtctggctgcccgaagagacgctgcacgcggtgcgcgattacgtcgtctcgatc
aagggcccgctgacgacgccggtcggcggcggcatccgcagcctgaacgtcgcgctgcgc
caggaactcgacctctacgtctgcctgcgcccgatccagtacttcaagggcgtgccgacg
ccgctgaaggagccggagaagaccaacatggtcatcttccgcgagaactccgaggacatc
tacgccggcatcgagtgggaagccaagagcgagaaggcgcagaaggtcatcaagttcctc
atcgaggaaatgggcgtcaagaagatccgcttcccggagacctcgggcatcggcatcaag
cccgtgtcgcaggaaggcaccgagcgtctggtgcgcaaggcgatccagtacgcggtcgac
aacgacaagcccagcgtgaccatcgtgcacaagggcaacatcatgaagttcacggaaggc
ggcttccgtgactgggcctacgcgctggcgcagcgcgagttcggcgcccagccgatcgac
ggcggcccgtggtgctcgttcaagaacccgaagacgggcaaggacatcgtcatcaaggac
tcgatcgccgacgccttcctgcagcagatcctgctgcgcccggccgagtactcggtgatc
gcgacgctcaacctgaacggcgactatgtctccgacgccctggccgcgcaggtcggcggc
atcggcatcgccccgggcgccaacctgtcggactcggtcgcgatgttcgaggccacccac
ggcaccgcgcccaagtacgccggcaaggactacgtcaacccgggctccgagatcctctcg
gccgagatgatgctgcgccacatgggctggaccgaggctgccgacctgatcatcagcgcg
atggagaagtccatcctcagcaagcaggtcacctacgacttcgcgcgcctgatggacggc
gcgacgcaggtctcctgctcgggcttcggcaaggtcatgatcgagcagatgggctga

DBGET integrated database retrieval system