KEGG   Rubrivivax gelatinosus: RGE_34940Help
Entry
RGE_34940         CDS       T01803                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
Organism
rge  Rubrivivax gelatinosus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3736256..3737548
Genome map
AA seq 430 aa AA seqDB search
MSRETPTTNTALMARRQAAVPRGVGQAHPVFIARGANAEIWDVEGRRYIDFAGGIAVLNT
GHCHPAVIDAVREQLELYTHTCFQVVAYEPYVELAERLNALAPGQAPKKTLFLTTGAEAV
ENAVKIARSYTRRGGIIAFTGGYHGRTLMTLGLTGKVAPYKSGFGPFPAEVFHAAFPNPL
HGVSVEDALASVRTILKNDIEPDRVAAFIVEPVQGEGGFYVAPPEFIAGLKAIADEHGIL
LIADEVQTGAGRTGTWYACEQWPVAPDLITTAKSLAGGFPLSAVTGRADVMDAPGPGGLG
GTYAGSPIACAAALAVLKAFEDQKLLERSRTMGQRLVKGLKEIAAGEPAIGDVRGLGAMV
AIELFEGGDPHRPAADLTRRVVAEAAARGLILLSCGSYGNVVRILVPLTASDALLDEGLA
IIADSFAALR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcgaaaccccgaccaccaacaccgctctgatggcccgccgccaggccgccgtg
ccgcgtggcgtcgggcaggcgcacccggtgttcatcgcccgcggcgccaacgccgagatc
tgggacgtcgaagggcggcgctacatcgacttcgccggcggcatcgcggtgctcaacacc
ggccactgccacccggcggtgatcgacgcggtgcgcgagcagctcgagctctacacccac
acctgcttccaggtcgtcgcctacgagccctatgtcgaactggccgagcgcctgaacgcg
ctggccccgggccaggcgccgaagaagacgctgttcctgaccaccggcgccgaggcggtg
gagaacgcggtgaagatcgcgcgttcgtacaccaggcgcggcggcatcatcgccttcacc
ggcggctaccatggccgcacgctgatgacgctgggcctgaccggcaaggtcgcgccgtac
aagagcggtttcggcccgttcccggccgaggtcttccacgccgcgttcccgaacccgctg
cacggcgtcagcgtcgaggacgcgctggcctcggtgcgcacgatcctgaagaacgacatc
gaacccgaccgtgtcgccgcgttcatcgtcgagccggtgcagggcgaaggcggcttctac
gtcgcgccgccggaattcatcgccgggctgaaggcgatcgccgacgaacacggcatcctg
ctgatcgccgacgaggtgcagaccggcgccggccgcaccggcacctggtacgcctgcgag
cagtggccggtggcgccggacctgatcaccaccgccaagtcgctggccggcggtttcccg
ctgtcggccgtcaccggccgcgccgacgtgatggacgcgcccggccccggcggtctgggc
ggcacctacgccggctcgccgatcgcctgcgccgcggcgctggcggtactgaaggctttc
gaggaccagaagctgctggagcgctcgcgcacgatgggccagcgcctggtcaagggcctg
aaggagatcgccgccggggagccggcgatcggcgacgtgcgcggcctgggcgcgatggtc
gcgatcgagctcttcgaaggcggcgacccgcatcgcccggccgccgacctgacgcgccgc
gtcgtcgccgaggccgcggcgcgcgggctgatcctgctgtcctgcggcagctacggcaac
gtcgtgcgcatcctggtgccgctgacggccagcgacgcgctgctcgacgaaggcctggcg
atcatcgccgacagcttcgccgcgctgcgctga

DBGET integrated database retrieval system