KEGG   Roseomonas gilardii: RGI145_04710Help
Entry
RGI145_04710      CDS       T04615                                 

Definition
(GenBank) nitrate ABC transporter, permease protein
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
rgi  Roseomonas gilardii
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:rgi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    RGI145_04710
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    RGI145_04710
Transporters [BR:rgi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    RGI145_04710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:complement(1090687..1091559)
Genome map
AA seq 290 aa AA seqDB search
MNAVTPIKGVPAGGPTSAPPEFRQPSALALKARHVAQHVVPPLVVLLVLGLVWQVLCSQP
DATLPSPTKVWSDSHDLIVDPFFDRGGLDKGLFWHLAASLSRVAMGFSIAVVVGIATGML
IGTSDFAMRGLDPLFQVLRTVPPLAWLPLSLAAFREAQPSAIFVIFITSVWPIIINTAVG
VRNVPADYRNVAKVLRMSLPDWFLRIVIPSAAPYIFTGLRIGVGLSWLAIIAAEMLIGGV
GIGFFIWDAWNSSNLSDIIVALVYVGVVGFLLDRLVALIGRLVTRGTATA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgtgaccccgatcaagggcgtgcccgcgggcggcccgaccagcgcgcccccg
gagttccgccagccctccgccctggcgctgaaggcccgccatgtggcgcagcacgtggtg
ccgccgctggtggtgctgctggtgctgggcctggtctggcaggtgctgtgctcgcagccc
gacgccaccctgccctcccccaccaaggtctggtcggacagccacgacctgatcgtcgat
cccttcttcgaccgcggcgggctggacaagggcctgttctggcacctcgccgcctcgctg
tcgcgcgtcgccatgggcttctccatcgcggtggtggtgggcatcgccacggggatgctg
atcggcacttcggacttcgccatgcgtggcctcgacccgctgttccaggtgctgcgcacc
gtgccgccgctggcctggctgccgctctccctcgccgccttccgcgaggcgcagccctcg
gcgatcttcgtgatcttcatcacctcggtctggccgatcatcatcaacaccgccgtcggc
gtgcgcaacgtgcccgccgactaccgcaacgtggcgaaggtgctgcggatgagcctgccc
gactggttcctgcgcatcgtcatcccttccgccgcgccctacatcttcaccgggctgcgc
atcggcgtcggcctgtcctggctcgccatcatcgcggcggagatgctgatcggcggcgtc
ggcatcggcttcttcatctgggatgcctggaactcctccaacctctccgacatcatcgtg
gcgctggtctatgtcggcgtggtcggcttcctgctcgaccgcctcgtcgccctgatcggc
cgcctcgtcacccgtggcacggccacggcctga

DBGET integrated database retrieval system