KEGG   Roseomonas gilardii: RGI145_20070Help
Entry
RGI145_20070      CDS       T04615                                 

Definition
(GenBank) acyl-CoA synthetase
  KO
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
rgi  Roseomonas gilardii
Brite
Enzymes [BR:rgi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     RGI145_20070
Lipid biosynthesis proteins [BR:rgi01004]
 Acyl-CoA synthetase
  Unknown
   RGI145_20070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:143609..145351
Genome map
AA seq 580 aa AA seqDB search
MLPTRNSLPRRLGSFATLPDALDYAAGGETGLSFYDGRGELVRALPYRELRQAAWQLARR
LVGAGLERGNRVAIIAETRPDVVEAFMACQYAGLVPVLLPLPVAFGGRQTYVEHVSRLTL
AARASALFVPEALQPWLAPFAAEAGLTIFGTVAALASAPEGTAEPVPLAEDEIAYLQFSS
GSTRFPMGIAVTQRALMENIRAILRHGLQVGAEDRAVSWLPLYHDMGLVGFLLAPLAGQV
TVDYLSPQEFARRPQLWLRLISSNRATLSYSPSFGYELCTRRGRPDPAKGPALDLSSWRA
AGIGGDMIRPHVLARFAETFGPDGFRADAFVPSYGMAEATLAISFAPLSKGLATDVVDLD
RLEREGLAMPPGDTARLREFALCGPPVPGTELEIRDATGAALPERRVGSVLVRGPGLMQG
YDERPEESTAVLSADGWLDTGDLGYRLNGQVVITGRAKDLIIVNGRNVWPQDLEWSVEQS
IPTARSGDAAAFSVEEEGAEQVVMLIEARGAPDSGERERLATEAAGMLRARHGVEARIVL
VPPGSLPRTSSGKLSRTRARSRYLAGHFTAGASTLAALPE
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgctcccgacacggaattcgctcccccggcgccttggctccttcgccaccctccccgat
gcgctggactacgccgctggtggggaaacgggcctgagcttctacgacgggcggggggag
ctggtcagggccctcccctatcgcgaattgcgccaggcggcatggcaactggcgaggcgg
ctggtcggcgcggggctggaacgcgggaaccgcgtggccatcatcgccgagacgcggccc
gacgtggtggaggccttcatggcctgccagtatgcggggctggtgccggtgctgctgccc
ttgccggtcgccttcggcgggcggcagacctatgtcgagcatgtttcccggctgaccctg
gcggcgcgcgcctcggcgctcttcgtgccggaggctctccagccatggctggcacctttt
gccgccgaggcgggactgacgatcttcggaaccgtggcggcgctggcctcggccccggaa
ggcaccgccgaaccggtgccgctggccgaggacgagatcgcctacctccagttctcctcg
ggcagcacgcgctttcccatggggatcgccgtcacccagcgggcgctgatggagaacatc
cgcgccatcctgcggcacgggctgcaggtgggcgcggaggaccgggcggtgtcctggctg
ccgctctatcacgacatgggcctcgtgggcttcctgctggcgcccctcgccgggcaggtg
acggtggactacctctcgccgcaggaattcgcgcggcggccgcagctctggctgcgcctg
atctcctccaaccgcgccaccctctcctacagccccagcttcggctacgagctctgcacc
cggcggggacggccggacccggccaagggcccggccctggacctttcctcctggcgcgcc
gcgggcatcggcggggacatgatccggccgcatgtgctggcgcgcttcgccgagaccttc
gggccggacggcttccgggcggacgccttcgtgcccagctacggcatggccgaggcgacc
ctggccatcagcttcgccccattgagcaaggggctggcgacggatgtggtggatctggac
cggctggagcgggagggtcttgccatgccccccggcgacacggcgcggctgcgggaattc
gccctttgcggccccccggtcccgggcaccgagctggagatccgcgacgccaccggcgcc
gccttgccggagcggcgggtggggagcgtcctggtgcgcggcccggggctgatgcagggc
tatgacgagcggcccgaggaaagcaccgccgtgctttcggcggatggctggctcgatacg
ggcgacctcggctaccgcctgaacggacaggtggtgatcaccggccgcgccaaggatctg
atcatcgtcaacggccgcaatgtctggccgcaggacctggaatggtccgtggagcagtcc
atccccacggcgcgcagcggcgacgccgccgccttctcggtggaggaggagggggcggag
caggtggtgatgctgatcgaggcacgcggcgcgccggacagcggggagcgcgagcggctg
gccaccgaggcggccggcatgctgcgggcgcgccatggggtcgaggcgcggatcgtgctg
gtgccgccgggcagcctgccgcgcacctcctcgggcaagctcagccgcacccgggcgcgc
agccgctatctggccgggcatttcacggcaggggccagcaccctggcggcgctgccggaa
tga

DBGET integrated database retrieval system