KEGG   Rhizobacter gummiphilus: A4W93_10660Help
Entry
A4W93_10660       CDS       T04831                                 

Definition
(GenBank) hypothetical protein
Organism
rgu  Rhizobacter gummiphilus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2379033..2384324
Genome map
AA seq 1763 aa AA seqDB search
MTSAIPARPFPVDFVRHLRGLATHRPHDTAVIAVRDDGGQLVEETIAYARLDQRVRALAA
QLQRDLSPGDRVLIALENGDDYAVSFFACFYAGVIAVPVFPPESRRAHHIGRLQAIAADA
GVRTILTHGSLVPLLEIVASVLPGARVVAVDGHGDTGADAWTELAASPSDIAFLQYTSGS
TSAPKGVMVTHASLMANMRALAEGFGVTDSDVFVTWLPLNHDMGLIGGLLQPIHAGIPVV
LMSPRYFMERPLRWLEAIARHRGTISGGPDFAFRLCNERITPQQAARLDLSSWAVAFSGA
EPVRPDTLDTFIALCAPGGFSPKAAYPCYGLAEATLFLTGGRRGEGMTATRYSARDLADR
AVSADASGVALAGCGRTVTDHAVRIADPDTLLPMAPGLVGEIWAAGPSITRGYWNKLEAT
LDTFVERDGRTWLRTGDLGFEHGGHLHIAGRLKDMIIVRGHNLYPQDIERAVEDAVDAVR
KGRVAAFCVDGPGTERIGVAAEVSRSMQKLIPPERLVEALSEAVGEFCGEPLAVVVLLNP
GGLPKTSSGKLQRRASRSGWLDGTLDAYAVLADGRLVVGSPTPAAPSVASPVAPAAGFAT
TLAALWHEVLKLDPAVTLRADAHFFGSGGSSLTAAELSARIEARWGVAIGPGDVFEHPRL
DDLARHVAERRQAAPRTPEAPVAEAVGPAVMSHAQERQWFLWRLDPAATAHHVAARLDLS
GDVGIGRLREAFARVVARHAPLRTVFREGTDGSAEPVVLHDLHVPVDEEDLRAADGAADE
ARLADALGRLNGQPFDLATGPLLRVACLRTGRDAHVLVLVMHHIVSDGASMQVLLDELAA
RLRDDGVEPPPLPLSYAAHAARQRARLAGGEGARQLAWWRATLGDDHPVLELPADHPRPA
QAQYTAGCLTLDVPGELVQGLRRRAAAEGATLFMVLLAGCQALLHRYTGQRDVRVGAPIA
NRSHDARGLVGLFVNTVVLRSVVHGRLPLSEVLARAKAAALGAQANQDLPFEQLVEALRP
ERSLSHNPLVQVTLNHIAEDFRPFESALGVSMTAYEVLRETVQFELTLETHEAPDGRLRV
SFVHAKELFEPDTVRALAAHYLTLLRAFVDQPGQALADVVLLDGIERERQAAWGRGAASA
AEPRWVHQFVEARARERPDAAAVLHGDQVLGYGELNRRANRLAHRLIALGVGPEARVGIA
VERSVDMVVCLLATMKAGGAYVPLDPAYPTERLHHMVRDSGIALVLCQGAVHDRLPAVPG
LVMIDVEADLAVDVQSGTESGERDPEVVLHGENLAYVIYTSGSTGLPKGVAVAHGPLASH
LRAIGEVYAVTPSHRELFFFSLSFDAAVEQWMTPLCGGGAIVLCDREELAGERFVDLVVR
HGVTTLHVPPAYLRVVAPLLADVPSQVRTCIVGGEAFPWADYTLARAAFRAPRIVNAYGP
TETIITPTAWVGGELPATASGSVPIGTPVGARHVHVLDDDLNLVPRGVIGELYVGGPEIA
RGYTGRPALTSDRFIADPFGAAGGRLYRTGDRVRWHADGHLEYFGRRDQQVKVRGFRIEL
GEIEARLLSLPGVREAVVGVLGDGGSERLVAHVGVGPGTAFDAEGLRAALKDQLPDYMVP
HAIVPVPALPLTPNGKVDRAALPAPAFGVPSGTVAPAGDLETAIAAIWAEALGVPRVGRH
DNFFDLGGHSLLLIKVHSRLAERLGLAVSMVDLFQHTTVSALAACAARGGAMPAATAGDV
QARAQRQRSHFLKRPTTAERATP
NT seq 5292 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagcgattccggcacggccgttccccgtggacttcgttcgtcacctgcgtggt
ctggcgacgcaccggccgcacgacacggcggtgatcgccgtgcgcgacgacggcggccaa
ctcgtcgaggaaacgatcgcctacgcccgcctcgaccagcgcgtgcgcgccctcgcggcc
cagctccagcgcgatctctcgcccggcgaccgcgtgctgatcgcgctcgagaatggcgac
gactacgccgtgagcttcttcgcctgcttctatgccggggtcatcgcggtgccggtgttc
ccccccgaatcgcggcgcgcccaccacatcggccgcctgcaggccatcgcggccgatgcc
ggcgtgcgcaccatcctcacccacggctcgctcgtgccgctgctcgagatcgtcgcgagc
gtgctgccgggcgcgcgcgtggtcgcggtcgatggccacggcgacaccggggccgacgcg
tggaccgaactcgcggcgtcgccgtccgacatcgcgttcctccagtacacctcgggttcc
acgtcggcaccgaagggcgtgatggtcacccatgcgagcctgatggcgaacatgcgggcg
ctggccgagggcttcggcgtgacggactccgacgtgttcgtgacgtggctgccgctgaac
cacgacatgggcctgatcggcgggctgctgcaaccgatccatgcgggcatcccggtggtg
ctgatgtcaccgcgctacttcatggagcgtccgctgcgctggctcgaggcgatcgcacgc
caccgcggcaccatcagcggcggaccggacttcgccttccgcctgtgcaacgagcgcatc
acgccgcagcaggcggcccgtctcgacctgtcgtcgtgggcggtcgcgttttcgggcgcc
gagccggtgcggcccgacacgctcgacacgttcatcgcgctgtgcgcgccgggaggtttc
tctccgaaggcggcttacccgtgctacggcctggccgaggcgacgctgttcctgaccggc
gggcgccgtggcgagggcatgaccgccactcgctactcggcgcgggacctggcggaccgg
gcggtgtccgcggacgcgagcggcgtcgccctcgcgggttgcggccggacggtcacggac
catgccgtgcgcattgccgaccccgacaccctgctgcccatggccccggggctcgttggc
gagatctgggccgccggcccgagcatcacgcgcggctactggaacaagctcgaggccacg
ctcgacaccttcgtcgagcgcgatggtcgcacgtggctgcggacgggtgacctgggcttc
gaacacggcggtcacctgcacatcgcgggccgcctgaaggacatgatcatcgtgcggggc
cacaacctgtacccgcaggacatcgaacgtgccgtcgaggacgcggtggacgccgtgcgc
aagggccgtgtggcggcgttctgcgtcgacgggcccggcaccgaacgcatcggcgtggcc
gccgaggtgtcgcgcagcatgcagaagctgatcccgcccgagcgcctcgtcgaggccctg
tcggaagcggtgggtgaattctgcggcgagccgctggcggtcgtggtgctgctcaacccg
ggcggacttccgaaaacctcgagcggcaagctgcagcgccgcgcgagccgcagcggctgg
ctcgacggcacgctggacgcctatgccgtgctggccgacggccgcctcgtcgtcggttcg
cccaccccggccgcgccgtccgtcgcgtcgccggtggccccggccgcgggcttcgccacc
acgctcgccgcgctgtggcacgaggtgctgaagctcgatccggcggtcacgctgcgcgcc
gacgcccacttcttcggcagcgggggcagctcgctcacggccgcggagctcagtgcgcgc
atcgaggcccggtggggtgtcgcgatcggccccggcgacgtgttcgaacacccccggctc
gacgacctcgcgcgccacgtcgccgagcggcggcaggccgcgccgcggacccccgaggcc
ccggtggccgaggcggtcggccccgccgtgatgtcgcatgcgcaggaacggcagtggttc
ctgtggcgcctcgatcccgcggccacggcacaccatgtggcggcgcggctcgatctgtcc
ggtgacgtcggcatcggccgcctgcgcgaggcgttcgcgcgtgtcgtcgcgcgccatgcg
ccgctgcgaaccgtcttccgggaagggacggatggctccgccgagcccgtcgtgctgcac
gacctgcacgtgccggtggacgaggaggacctgcgcgccgcggacggtgcggccgacgag
gcccgcctcgcggacgccctgggccggctgaacgggcagccgttcgacctcgccacgggg
ccgctgctgcgcgtggcctgcctgcgcacggggcgcgacgcgcacgtgctcgtcctggtg
atgcaccacatcgtgtcggacggggcctcgatgcaggtgctgctcgacgagctggccgcc
cggctccgtgacgacggggtcgaaccgcccccgctgccgctctcgtacgcggcccatgcg
gcccgccagcgcgcgcggctcgccggcggcgagggggctcgccagctcgcgtggtggcgc
gccacgctgggcgacgaccatccggtgctcgaactgccggccgatcacccgcgccccgcc
caggcgcagtacaccgcgggctgcctgaccctcgacgttcccggcgagctggtccagggc
ctgcgccggcgggcggcggcggaaggggccacgctgttcatggtgctgctggccggctgc
caggcgctgctccatcgctacacgggacagcgtgacgtgcgcgtgggcgcccccatcgcg
aaccgcagccacgacgcccgcggtctcgtcggcctcttcgtgaacaccgtggtgctgcgc
agcgtggtgcacggccgcctgccgctctccgaggtgctggcacgcgccaaggcggcggcc
ctcggcgcgcaggcgaaccaggacttgccgttcgagcagctcgtcgaggcgctgcgcccc
gagcggagcctcagccacaacccgctcgtgcaggtgacgctgaaccacatcgccgaggat
ttccgcccgttcgaatcggcgctgggtgtgtcgatgacggcgtacgaggtgctgcgcgag
acggtgcagttcgagctcacgctcgagacccacgaggcgccggacgggcgcctgcgtgtg
tcgttcgtgcacgcgaaggaactgttcgaacccgacaccgtccgtgcgctggccgcgcac
tacctgaccctgctgcgcgccttcgtggaccagcccggacaggccctcgccgacgtggtg
ctgctcgacggcatcgaacgcgaacgccaggccgcctggggccgcggggcggcgtccgct
gccgagccgcgctgggttcaccagttcgtcgaggcccgggcccgcgaacggcccgatgcc
gccgccgtcctccatggcgaccaggtcctcggatacggcgaactcaaccgccgggcgaac
cgcctcgcgcaccggctgatcgcgctgggcgtggggcccgaggcccgggtgggcatcgcc
gtcgagcggtcggtcgacatggtggtgtgcctgctcgcgacgatgaaggcgggcggcgcc
tacgtgccgctcgaccccgcctatccgacggaacggctccaccacatggtgcgcgacagc
ggcatcgcgctggtactgtgccagggggcggtgcacgaccggctgcccgccgtgccgggc
ctcgtgatgatcgacgtggaggcggacctcgcggtcgacgtgcagtccggcaccgagtcc
ggcgagcgcgacccggaggtcgtgctgcacggagagaacctcgcctacgtgatctacacg
tcgggatcgacgggcctgccgaagggcgttgccgtggcccacggaccgctcgcgagccac
ctgcgagccatcggcgaggtgtacgcggtgacaccgtcgcaccgcgaactcttcttcttc
tcgctgagcttcgatgccgcggtggagcaatggatgaccccgctgtgcggcggcggcgcc
atcgtgctgtgcgatcgcgaggaactcgcgggcgaacgtttcgtcgacctcgtggtgcgc
cacggggtgacgacgctgcacgtcccgccggcctacctgcgggtggtggcgccgctgctc
gccgacgtgccctcgcaggtccgcacctgcatcgtggggggcgaggccttcccctgggcc
gactacacgctcgcccgcgcggccttccgcgcgccgcgcatcgtcaatgcctacggcccc
accgagaccatcatcacgccgacggcgtgggtcggcggggagctgccggcgactgcctcg
ggcagcgtgcccatcggcaccccggtgggggcgcgccacgtgcacgtgctggacgacgac
ctgaacctcgtgccacgcggcgtgatcggcgagctctacgtgggtggcccggagatcgcg
cggggctacaccggccggccggccctcacgagcgaccggttcatcgccgacccgttcggc
gccgcgggcggccgcctgtaccgcacgggcgaccgtgtgcgctggcacgccgatggccac
ctcgagtacttcggccgccgcgaccagcaggtcaaggtgcggggcttccgcatcgagctg
ggagagatcgaggcgaggctgctctccctgcccggggtgcgggaggcggtggtcggcgtg
ctgggcgacggcggaagcgaacgcctcgtggcccatgtgggcgtgggtccggggacggcg
ttcgatgccgaaggactgcgtgcggcgctcaaggaccagttgcccgactacatggtgccg
cacgccatcgtgccggtgccggcgctgccgctcacgcccaacggcaaggtggaccgcgcg
gcgctgccggctcccgccttcggtgtcccgtccggcaccgtggcaccggccggcgacctg
gaaacggccatcgccgccatctgggccgaggccctcggtgtgccgcgggtgggccgccat
gacaacttcttcgacctcggcgggcattcgctcctgctgatcaaggtccacagccggctc
gccgaacgcctgggcctggcggtctcgatggtcgacctgttccagcacaccacggtcagc
gcgctggccgcgtgcgcggcgaggggcggcgccatgccggccgccaccgccggcgacgtg
caggcacgggcgcagcggcagcgcagccatttcctcaaacgcccgacaaccgcggaaaga
gcgacaccatga

DBGET integrated database retrieval system