KEGG   Rhizobacter gummiphilus: A4W93_14140Help
Entry
A4W93_14140       CDS       T04831                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
rgu  Rhizobacter gummiphilus
Pathway
rgu00020  Citrate cycle (TCA cycle)
rgu00480  Glutathione metabolism
rgu01100  Metabolic pathways
rgu01110  Biosynthesis of secondary metabolites
rgu01120  Microbial metabolism in diverse environments
rgu01130  Biosynthesis of antibiotics
rgu01200  Carbon metabolism
rgu01210  2-Oxocarboxylic acid metabolism
rgu01230  Biosynthesis of amino acids
Module
rgu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rgu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:rgu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A4W93_14140
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A4W93_14140
Enzymes [BR:rgu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A4W93_14140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ARN20946
UniProt: A0A1W6L9N5
LinkDB All DBs
Position
3179010..3180263
Genome map
AA seq 417 aa AA seqDB search
MYQHIKVPASGQKITVNADFSLNVPDQPIIPFIEGDGTGADITPVMIKVVDAAVAKAYGG
KKKIEWMEIYAGEKSTKVYGPDVWLPEETLQVLREYVVSIKGPLTTPVGGGIRSLNVALR
QELDLYVCLRPIQYFKGVPSPVKEPEKTNMVIFRENSEDIYAGIEFEAESDKAKKLIKFL
QDEFGVKKIRFPASSGIGIKPVSREGTERLVRKAIQYAIDNDKPSVTIVHKGNIMKYTEG
GFRDWAYALAQKEFGAQLIDGGPWCKFKNPNTGREITVKDSIADAFLQQILLRPAEYSVI
ATLNLNGDYVSDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEILS
AEMMLRHMGWTEAADLIISSMEKSIESKKVTYDFARLMDGATQVSCSGFGQVMIDHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagcacatcaaagtgcccgccagcgggcagaagatcaccgtcaacgccgacttt
tccctgaacgttccggatcagcccatcatcccgttcatcgaaggtgacggcaccggcgcc
gacatcacgccggtcatgatcaaggtggtcgatgcagcggtggccaaggcctacggcggc
aagaagaagatcgaatggatggagatctacgccggcgagaagtcgacgaaggtctacggc
cccgacgtgtggctgccggaagagacgctgcaggtcctgcgcgagtacgtcgtgtccatc
aagggcccgctgaccaccccggtcggtggcggcatccgctcgctgaacgtcgcgctgcgc
caggaactcgacctgtacgtctgcctgcgccccatccagtacttcaagggtgtgccgtcc
ccggtcaaggaacccgagaagaccaacatggtcatcttccgcgagaactcggaagacatc
tacgccggcatcgagttcgaagccgagagcgacaaggccaagaagctgatcaagttcctg
caggacgagttcggcgtcaagaagatccgcttccccgcctcgtcgggcatcggcatcaag
ccggtctcgcgcgaaggcaccgagcgcctggttcgcaaggcgatccagtacgcgatcgac
aacgacaagccgagcgtgaccatcgtccacaagggcaacatcatgaagtacaccgaaggt
ggcttccgtgactgggcctacgccctggcccagaaggaattcggcgcccagctgatcgac
ggtggcccgtggtgcaagttcaagaacccgaacacgggtcgtgaaatcaccgtcaaggac
tccatcgccgacgcgttcctgcagcagatcctgctgcgcccggccgagtactcggtcatc
gccacgctgaacctgaacggcgactacgtgtccgacgccctggccgcgcaggtcggcggc
atcggcatcgccccgggcgcgaacctgagcgactccgtcgccatgttcgaagccacccac
ggcaccgccccgaagtacgccggcaaggactacgtcaacccgggttcggagatcctctcc
gccgagatgatgctgcgccacatgggctggaccgaagcggccgacctgatcatcagctcg
atggaaaagtccatcgagtcgaagaaggtcacgtacgacttcgcccgcctgatggacggc
gcgacgcaagtgtcgtgctcgggcttcggtcaagtgatgatcgaccacatgtga

DBGET integrated database retrieval system