KEGG   Rhizobacter gummiphilus: A4W93_28225Help
Entry
A4W93_28225       CDS       T04831                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rgu  Rhizobacter gummiphilus
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rgu00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    A4W93_28225
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    A4W93_28225
Enzymes [BR:rgu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     A4W93_28225
Peptidoglycan biosynthesis and degradation proteins [BR:rgu01011]
 Precursor biosynthesis
  Racemase
   A4W93_28225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6184189..6185289
Genome map
AA seq 366 aa AA seqDB search
MPRPIEALIHTDALAHNLVRARRMAPDAKVWAVVKADAYGHRIAHAFEGLRGADGFALLD
IAEAEQLRRLGWRGPILLLEGCFDARDLEACSRLNLWHVVHHEAQIDWLALHKTTWPHHV
FLKMNTGLNRLGFTPAAFRSAWLRLSGLTQVDEISLMTHFAEADGPRGVDHQVAAFEAAT
HDLPGERSLCNSAATLRESPARPNVRGDWVRPGIMLYGASPDHPEHGIAHWDLQPTMTLR
TRLIATQDLKPGDAVGYGGAFVADTPMRIGVAACGYADGYPRSAPAGTPVLVDGRRTRLA
GRVSMDMVTVDLTGLPDVGPGSEVTLWGRGPGGVVLPIDEVAHPAGTVGYELMCAVAPRV
PVSAVP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgccccgtcccatcgaagcgctgatccacaccgacgccctggcgcacaacctggtccgg
gcccgtcggatggcgcccgacgcgaaggtctgggccgtcgtgaaggccgacgcctacggc
caccgcatcgcccatgccttcgagggtctgcgcggtgccgacggcttcgcgctgctcgac
atcgccgaggccgaacagctccgcaggctcggctggcgcggccccatcctgctgctcgaa
ggctgcttcgacgcccgggacctggaggcctgctcccgcctgaacctgtggcacgtggtg
caccacgaggcccagatcgactggctggccctccacaagaccacctggccgcaccacgtg
ttcctgaagatgaacaccggcctgaaccgcctcggcttcacgccggcagccttccgctcg
gcctggctgcggctgtcgggcctgacgcaggtggacgagatctcgctgatgacccacttc
gccgaggccgacggcccgcgcggggtggaccaccaggtggccgccttcgaggccgccacc
cacgacctgcccggcgaacggtcgctgtgcaacagcgcagccacgctgcgcgagtcgccc
gcgcgcccgaacgtgcgcggcgactgggtgcgccccggcatcatgttgtacggcgcctcg
cccgaccaccccgagcacggcatcgcccactgggacctccagcccacgatgaccctgcgc
acccgcctgatcgccacccaggacctgaaaccgggcgacgcggtgggctacggcggcgcg
ttcgtcgccgacaccccgatgcgcatcggcgtggccgcctgcggctatgccgacggctac
ccgcgctcggcccccgccggcaccccggtgctggtcgacggccggcgcacgcgcctggcc
gggcgggtgtcgatggacatggtcaccgtcgacctgacgggcctgcccgacgtcggcccc
ggctcggaagtcacgctgtggggccgcggccccggcggcgtggtgctgcccatcgacgag
gtggcccaccccgccggcaccgtgggctacgagctgatgtgcgccgtggcgccccgggtg
ccggtgagcgcggtgccgtga

DBGET integrated database retrieval system