KEGG   Rhodococcus sp. B7740: NY08_424Help
Entry
NY08_424          CDS       T03776                                 

Definition
(GenBank) Gamma-aminobutyrate:alpha-ketoglutarate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rhb  Rhodococcus sp. B7740
Pathway
rhb00250  Alanine, aspartate and glutamate metabolism
rhb00410  beta-Alanine metabolism
rhb00640  Propanoate metabolism
rhb00650  Butanoate metabolism
rhb01100  Metabolic pathways
rhb01120  Microbial metabolism in diverse environments
Module
rhb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rhb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NY08_424
   00650 Butanoate metabolism
    NY08_424
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NY08_424
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NY08_424
Enzymes [BR:rhb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     NY08_424
Amino acid related enzymes [BR:rhb01007]
 Aminotransferase (transaminase)
  Class III
   NY08_424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AJW38456
UniProt: A0A0D5A6I0
LinkDB All DBs
Position
457763..459028
Genome map
AA seq 421 aa AA seqDB search
MTASTRTHLSPALKQATPIVVDHGKGSWIIGTDGRKYLDFTTGIGVTSTGHCHPRVVEAA
REQVGKIIHAQYTTVMHQPLLALTDKLGEVLPLGLDSVFYANSGSEAVEASIRLARMATG
RPNIIAFHGGFHGRTVAAASLTTAGTKFRSGFSPIMGGVHIAPFPYAFRYGWDMDTAVAF
ALKELDYLLMTMSSPADTAAFIIEPVLGDGGYLPTPPEFLEGLRERADTHGIVLIVDEVQ
AGVGRTGKFWGHQHSSITPDIVITAKGLASGFPISAIAASTELMSKAWPGSQGGTYGGNA
VAAAAGVATLDVVREEGLVANAAAQGRVLLDGLLALKSEHSAIGDARGLGLMQALEFVDS
AGNPDAAAALRVQQGAIDEGLLLLTCGALGNVVRIIPALIVSDDEMRQGLDALSRTLKNV
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgacagcgtcgactcgcacccacctcagcccggcactcaagcaggcgaccccgatcgtc
gtcgatcacggaaagggcagctggatcatcggcacggacgggcgcaagtacctcgacttc
accaccggtatcggcgtcaccagcaccgggcactgccatccccgcgtggtcgaggccgcc
cgcgagcaggtgggcaagatcatccacgctcagtacacgacagtcatgcatcagccgctg
ctggcgctgaccgacaagctcggcgaggtactaccgctcggtctcgacagcgtcttctac
gccaactccggctccgaggccgtcgaggcatcgattcggttggcgcgcatggcgaccgga
cggcccaacatcatcgcgttccacggagggttccacggacgcacggtggcggccgcgtcg
ttgaccaccgcgggcaccaagtttcggtccggattctcaccgatcatgggcggtgtgcac
atcgcgccgttcccgtacgcgttccgatacggctgggacatggacaccgccgtcgccttc
gcgttgaaggaactcgactacctgctgatgacgatgtcgagccccgccgacaccgctgcg
ttcatcatcgagccggtactcggtgacggcggttatctgcccacgcctccggagtttctc
gagggcctgcgcgaacgcgcggacacccacgggatcgtcctcatcgtcgacgaggtgcaa
gcgggggtcggccgtaccgggaaattctggggtcatcagcactcgtcgatcactcccgac
atcgtcatcaccgcgaaaggtctggccagcggatttccgatctcggcgatcgcggcatcg
accgagttgatgagcaaggcctggcctggatcgcagggcggcacgtacggcggcaatgcc
gtcgccgctgcggcgggtgtcgcgacgctcgacgtcgtgcgtgaggaaggtctggtcgcc
aacgctgccgcgcagggccgagttctgctcgacggcctgctcgcactgaagtccgagcac
tctgcaatcggtgatgcacgtggactcggcttgatgcaggcactcgaattcgtcgacagc
gcaggcaatcccgatgctgcggccgctctgcgcgtacaacagggcgcgatcgacgagggg
ttgttgctgctcacctgtggcgcgctcggcaacgtggtccggatcatcccggcgctgatc
gtgagcgacgacgaaatgcggcagggcctcgacgcgttgtcgcgcacactgaagaacgtg
ctgtga

DBGET integrated database retrieval system