KEGG   Sinorhizobium fredii NGR234: NGR_b04710Help
Entry
NGR_b04710        CDS       T00888                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    NGR_b04710
Enzymes [BR:rhi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NGR_b04710
DNA repair and recombination proteins [BR:rhi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     NGR_b04710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
pNGR234b:complement(472205..474757)
Genome map
AA seq 850 aa AA seqDB search
MALEIYRKKRNFGSTPEPKGRKARRSGNSFVVQKHDATRLHYDFRLEMDGVLKSWAVTKG
PSLIPGEKRLAVHVEDHPLEYGDFEGTIPKGEYGGGTVILWDRGTWSPIGDADRGYAKGH
LDFELSGEKLGGRWHLVRMAGKPREKRENWLLIKGDDEAARSEDDPDILEERPESVLTGR
EIKDVAGEEPGWSSKIGRIRKKGRGTTKAASQQAERQAVANVPDPAKIKGAKAAPLPDFV
EPALATLVSSAPAGERWLHEIKFDGYRLQARIEAGRVKLLTRGGLDWTKKFGKTLVSASQ
ALPIGTALIDGEIVVETGSGASDFSALQADLSEGRSDRFRFYVFDLLHLDGYDLRPLPLT
KRKELLGQLIGEADGIIRFSNHFEEEGKLVLRHACRLSLEGVVSKLRDAPYRTGRNKSWV
KSKCSARQEFVVAGYVPSTTSRKAIGSLVLGVYDAGKLHHVGRVGTGFTAALAEDLFKRL
DRLRTTHSPFSARLSAEDARQVRYVKPELVAEIEFRAWTADGHLRHASFRGLREDKLASD
IVREAPRSATAQPKPPQRTVKLTHPDRLYWPDEGVTKEGLADYYAEVWRFIAPHIVGRPL
ALVRCPNGIAGEQFFQKHAWKGLNPNIVLVNDPKEPPDEQLLSIRNLDGLTALVQSAVLE
IHPWGSTVADWERPDTIIMDLDPGDDVPFEAVIEAAFETADRLKAAGLVPFVKTSGGKGL
HVVAPLKPKAEWPVAKAFTKSIADAMASDSPDRFVSTITKSKRRGKILVDYLRNQRGATA
VAAYSTRARPGAAVSMPLSWDELAPGIGPAYFTVENTPTRLASLSTDPWGEFRAAAVPLA
EPKVRRKKAA
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggctctcgagatctatcggaaaaagcgcaatttcggatcgacccctgaaccgaaaggc
cgcaaggcgcgccgctcgggcaacagcttcgttgtccagaagcacgacgccacacgcctg
cactatgatttccgcctggagatggatggcgttttgaagagctgggccgtcaccaagggg
ccgagccttatccccggcgagaagcgactggcggtgcacgtcgaggatcacccgctcgaa
tatggggatttcgaggggacgatcccgaagggagaatatggcggcggaaccgtaattctc
tgggatcgtggcacctggtcgccgattggcgacgcggatcggggctacgccaaggggcat
ctcgacttcgaactcagtggcgaaaagcttggcgggcgctggcacctggttcggatggcc
ggcaaaccccgcgaaaagcgtgagaattggctgctgatcaagggtgacgacgaggcggcc
agatccgaagacgaccccgacattctcgaggaacggccggaatcggttctgaccggccgc
gaaatcaaggatgtggcgggcgaagagccgggctggtcatcgaagataggcaggatacgc
aagaagggccgcggcacgacgaaagccgcttcgcaacaagcggagcgccaggccgttgcc
aacgttcctgatcccgccaaaataaagggcgccaaggctgcgcctttgccggatttcgtc
gagccggccttggccacccttgtttcatccgctcctgccggcgagcgctggctccacgaa
atcaagttcgacggttacaggctgcaggcgcggatcgaagctggccgcgtcaagcttctc
acccgcggcgggctggactggaccaagaaattcggaaagacgctggtctcggcctcgcag
gctctgccgatcggaacggcgctgatcgatggtgagatcgtcgtcgaaaccggttctggt
gcgtcggacttctcggcgctgcaagccgacttgagcgaaggtcgcagcgaccgcttccgg
ttttacgtgttcgaccttcttcatctcgatggctacgatctgcgccccctgccgctcacc
aaacggaaagagctgctcggacagctgatcggcgaagcggacgggatcatccgcttcagc
aatcacttcgaggaggaaggcaagctggtgctgcgtcacgcctgcaggctgagccttgaa
ggtgtcgtctcgaaactgcgcgacgcgccctatcgcaccggccggaacaagagctgggtc
aaatccaagtgctcggcacgccaggagttcgtggtcgctggctacgtgccctcgaccacg
tcgagaaaggcgatcggctcgctggtgctcggcgtctacgatgccggcaagcttcaccac
gtcgggcgggttggcacggggttcactgcggcgctcgccgaagacctcttcaaaagactg
gaccgcctgaggacgacgcatagcccgttttcggcgcggcttagcgcggaagacgcgcgc
caggtgcgatacgtcaagcccgagctcgtcgccgagatcgagttcagggcctggaccgcc
gacggccatctgcgccacgcgtcgttccggggtttgcgagaagacaagctcgccagcgac
atcgtgcgggaggcacccaggtccgcgaccgctcagcccaaaccgccgcagcggaccgtc
aagctcacgcacccggaccggctctactggcctgatgaaggcgtgacgaaagaggggctc
gccgactactacgccgaggtctggcgcttcatcgcgccgcatatagtcggacgtcccctg
gcgttggtccgatgcccgaacggcattgccggcgagcagtttttccagaaacacgcctgg
aaggggctgaaccccaacatagtgctcgtcaatgatccgaaggagccacccgacgaacag
cttttgagcatcaggaacctcgacggcctgacggcgctcgtccagtcagccgttctcgaa
atccacccgtggggatcgacggtggccgactgggaaaggccggacacgatcatcatggat
cttgatccgggcgatgacgtgccattcgaagctgttatcgaagccgcgtttgagaccgct
gaccggctgaaagcggccggtcttgttcccttcgtcaagacatccggcggcaaaggcctt
cacgtcgtagcccccttgaagccaaaggcagaatggcccgtagccaaagcttttaccaag
tcgattgccgacgcgatggcgtccgacagtcccgaccgcttcgtgtcaacgatcaccaaa
tcgaagcgccgtggcaagatcctggtcgattatctcagaaaccaacgcggagcgactgcc
gttgcagcctattcgacgagagcgcgaccgggggctgcggtatcgatgccgctctcctgg
gatgaactggcccctggcataggcccggcctacttcacggtggagaatacgccgacgcgg
cttgcatctttgagcaccgacccgtggggggaatttcgcgccgcggccgttccactggcg
gagccgaaggtcagacgaaagaaagctgcctga

DBGET integrated database retrieval system