KEGG   Sinorhizobium fredii NGR234: NGR_b15170Help
Entry
NGR_b15170        CDS       T00888                                 

Gene name
nrtB
Definition
(RefSeq) Nitrate transport permease NrtB
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
rhi  Sinorhizobium fredii NGR234
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:rhi00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    NGR_b15170 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    NGR_b15170 (nrtB)
Transporters [BR:rhi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    NGR_b15170 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RhizoBase: 
UniProt: 
LinkDB All DBs
Position
pNGR234b:1525848..1526741
Genome map
AA seq 297 aa AA seqDB search
MSVTNLKLEPQAAPQPLANVIALSYPARPGIDRRLSRLVAQAVANLLPLLVTLSFFTLAW
QVICSSPDSSLPAPSRVFEESWELIAHPFYAGQGVDQGLFWHVFASLQRVALGYAMAAAV
GIALGVLVGQSALAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDGNPSAIFVIFITAIWPI
IINTAVGIRNIPQDYQNVARVLRLNGFEYFAKIMLPAAAPYIFTGLRIGIGLSWLAIVAA
EMLIGGVGIGFFIWDAWNSSLISDIIVALIYVGIVGFLLDRLIALIGRAVTRGTANA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaccaatctcaagctcgaaccgcaggcggcgccgcagcctttggccaacgtc
atcgcgctcagctaccccgcgcgccccggcatcgatcgccgcctgtcgcgcctcgtcgcc
caggctgtcgcaaatctcttgccgttgctcgtcacgctatcgttcttcactctcgcctgg
caggtcatttgctcgtcacccgactcgagcctgcctgcgccgtcccgcgtcttcgaggag
agctgggagttgatcgcccatcccttctatgccggacagggcgtcgaccagggactgttc
tggcatgttttcgccagcctgcagcgcgtcgcgctcggctatgccatggccgccgcggtc
ggcatcgcccttggtgtgctcgtcggccagagcgcgctcgccatgcgcggcctcgacccg
atcttccaggtgctgcgcaccgtgccaccactcgcctggctgccgctttcgctcgccgcc
ttccaggacggcaacccatcggcgattttcgtcatcttcatcacggcgatctggccgatc
atcatcaacacggcagtcggcatccgcaacattccgcaggactaccagaacgtcgcccgg
gtgctgcgcctcaacggcttcgagtatttcgccaagatcatgctgcccgccgccgcccct
tacatcttcacgggcttgaggatcggcatcgggctctcctggctggcgatcgtcgctgcc
gagatgctgatcggcggcgtcggcatcggcttcttcatctgggacgcctggaattcgtcg
ctgatcagcgacatcatcgtggcgctgatctatgtcggcatcgtcggcttccttctcgac
cgtctcatcgccctgatcggccgcgcagtcacccgcggcaccgcgaacgcctga

DBGET integrated database retrieval system