KEGG   Sinorhizobium fredii NGR234: NGR_c08520Help
Entry
NGR_c08520        CDS       T00888                                 

Gene name
sodC
Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rhi  Sinorhizobium fredii NGR234
Brite
Enzymes [BR:rhi01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NGR_c08520 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 7792077
NCBI-ProteinID: YP_002825396
RhizoBase: NGR_c08520
UniProt: C3M8U7
LinkDB All DBs
Position
912673..913194
Genome map
AA seq 173 aa AA seqDB search
MMIRVVIALAAAVGLAATASAQQSSQTATAEFVGKDGTDTGRATLTSGGKGVLIEMEVSG
LPKDTWVAFHVHETGVCDVADGFESAGKHFLDGDEGAEHGFLAAHGPHAGDMPNQFVGAD
GILRAQVFNSFVSLDEQATAIRGRALVIHARSDDNRSQPAGDAGDRLACAVIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgatgatcagggtggtaatcgcgctcgccgctgccgtgggactggcggcgactgcttcg
gcgcagcaatcatcgcagacggcaacggccgaattcgtcggcaaggacggcacggacacg
ggccgggcgacgttgacctccggcggcaagggtgtgctgatcgagatggaggtcagcggc
cttcccaaggacacctgggtagccttccacgtccacgaaacgggagtgtgcgacgtagcg
gacggcttcgagtctgccggcaagcattttctcgacggagatgagggcgccgagcacggc
tttctcgccgcccacggcccgcatgccggcgacatgcccaatcaattcgtcggggccgac
ggcatcttgcgcgcccaggtgttcaacagcttcgtttcgctcgatgaacaggcgacggcc
attcgcggacgcgccctggtcatccatgcgcgctcggacgacaaccgcagccagccggcc
ggagacgccggcgaccggctcgcctgcgccgtcatcaaataa

DBGET integrated database retrieval system