KEGG   Rhizobium sp. LPU83: LPU83_pLPU83d1249Help
Entry
LPU83_pLPU83d1249 CDS       T03046                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rhl  Rhizobium sp. LPU83
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rhl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LPU83_pLPU83d1249 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    LPU83_pLPU83d1249 (sucA)
   00380 Tryptophan metabolism
    LPU83_pLPU83d1249 (sucA)
Enzymes [BR:rhl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     LPU83_pLPU83d1249 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
LinkDB All DBs
Position
pLPU83d:1252127..1255087
Genome map
AA seq 986 aa AA seqDB search
MNHAIDRQPANEIFSQTSFLDSVNASYIESLQARYLEDPSSVGAEWRDFFSSLDDDATAV
RRTVEGASWKLANWPIPLNGDLVSALDGDWARADKDAYRQGKAGTGAVSESEMLTVNRDT
ARALTMIRAYRMRGHLHANLDPLGLKAPENDEELNPTSYGFGDDVLNRAVFIDGALGVES
ATIREIVAALRSAYCGTIGYEYMHISDPVQRGWIQERVEARNTTPELTPDRKRAILKKLV
EVTGYERYLNKKFVGTTRFGIDGAETTIVALEEILERGAALGVAEVVFGMAHRGRLNVLS
QVIRKPHRALFSEFKGGSFFPDEVEGSGDVKYHLGTSSDREFGGKTVHLSLVANPSHLEI
IDPVVLGKVRAKQEQRNDSVERATVLPLLIHGDAAFAGQGVVAESLGLSGLKGYRTGGSV
HLIINNQVGFTTDPSYSRSSPYPSDVAKTVEAPIFHVNGDDPEAVARVARLAIEYRQTFH
KPVVIDLICFRLFGHNEGDEPSFTQPAMYKEIRSHKSTLEIYAERLILEGLVGKSEIEDA
SARWSEYLDAELEASKSYKPKKGDWLDGKWAGLGSGKSESDEEPDSPTGVDTTRLRTIGE
KITTLPEGFNVHPTVGRFIEARRKTIEAGKGMDWATAEALALGSLADDGYPVRLSGQDSE
RGTFSQRHSVIIDQETGTRYMPLSSIRPGQAPCETFNSMLSEEAVLAFEYGYSLAEPRAL
VVWEAQFGDFANGAQVVFDQFLSSAERKWLRMSGLVCLLPHGYDGQGPEHSSARLERYLQ
SSAEGNWQVANCSTPANYFHVLRRQLTRDFRKPLILMTPKSLQRHKRCKSDLSELDVGAR
FQRILRDDSEMGGESSTKLVKDAKIRKVLLCSGKVYYDLEEERSKRAINDVYLLRVEQLY
PFPARALAAELARFPTASIVWCQEEPKNMGAWSFVEPYVEWALRHARGTLDRPEYVGRPA
SASTATGQMSRHLAEVGLFMDTAFAP
NT seq 2961 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatgcgatcgatcggcaaccagccaatgaaatcttctcgcagacatcgtttctc
gatagcgtcaacgcatcctacatcgagagtttgcaagcccgctatctggaggatcccagc
tcggtcggtgcagagtggcgggattttttcagctcgttggatgatgatgcaacagccgta
agacgcaccgtggagggcgcctcctggaaattggcaaattggcccattccattgaatggc
gacctggtttccgccctggacggggattgggcgcgggcggacaaggatgcttaccgtcaa
ggaaaggccggaactggtgccgtgtccgaaagcgaaatgctcaccgtgaaccgcgatacc
gcccgcgctttgacgatgatccgcgcttaccggatgcgtggtcatctccacgccaacctc
gacccgttgggcctaaaggccccggagaatgatgaggaactgaaccctacgtcatacggg
ttcggtgacgatgttcttaatcgtgcggtgttcatcgacggcgccctcggggtcgagagc
gctacgatcagagagatagtggcggctttgcgtagcgcctactgcggtaccatcggctat
gagtacatgcacatttccgatccggttcaaagaggatggattcaagagcgcgttgaagca
aggaacacaactccggagctgacgccggaccgcaagcgcgcaattctgaagaagctcgtc
gaggtcacggggtacgagcgctacctcaataagaagttcgtaggcacgacccgcttcggc
atcgacggtgcggaaacgacaatcgttgcgctggaagaaatcctcgaacgcggtgccgcg
ctcggcgtggccgaggtcgtcttcggaatggcacatcgcggacgcttaaacgtccttagt
caagtgatccgcaagcctcaccgcgcactcttcagcgagttcaaaggtggttcgttcttc
cccgacgaggtcgagggatccggcgatgtgaagtatcatctcggcacgtcatcggaccgg
gaattcggcggcaagacggttcacctgtccttggttgcaaacccgtcccatctcgagatc
atcgatccggtggttctaggcaaggttcgcgcgaagcaggagcagcgcaacgattcggtc
gagcgagcgacagttttgcctctcctcatccacggggacgcggccttcgccgggcagggg
gtcgtggccgagagccttggcctgtcgggtctgaaggggtatcgaaccggcggctcggtt
catttgatcatcaacaaccaggtcggcttcacgacggatccgagctactccaggtcgtcg
ccatatccgtctgacgtggcgaagacggtcgaagcgccgatcttccatgtgaacggcgac
gatcctgaggcggtggctcgtgttgcaaggctcgcgatcgaatatcgccagacattccac
aaaccggtcgtcatcgatctgatttgtttcaggctcttcggtcacaacgagggcgacgag
ccatcgttcactcagccggcgatgtacaaggagatccgctcacataaatccacgctggaa
atctatgcggagcgtctcatcttagaaggcctcgtcgggaagagcgaaatcgaggacgct
agcgcaaggtggtctgagtatctcgacgccgagctggaagcatcgaaatcctacaagccc
aagaagggcgactggctggatggaaaatgggccgggctcgggtcgggcaaatcggagagc
gatgaggaacccgacagtccgacgggcgtcgacacgaccaggctgagaaccatcggggaa
aagatcacgacccttcccgaaggattcaacgtgcatccgacagtcggtcgcttcatcgag
gcgcggcggaagactatcgaggcgggcaagggtatggattgggcgacggcagaagcgctc
gcgctcggatcactggccgacgacggctatcctgtccgactgtcgggccaggatagcgaa
cgcgggacgttctcgcagcgccattcagtgatcatcgatcaggagaccggcacacgttac
atgccgctgagcagcatccgccctggacaggcgccctgcgagacgttcaactcgatgctg
tcggaggaggcggttctcgctttcgagtatggctactcgcttgccgagccgagagccttg
gttgtctgggaggctcagtttggcgacttcgcaaacggggcccaggtggtgttcgaccag
ttcctgtcgtctgccgaacgcaagtggctccggatgtcgggtctcgtctgccttcttcct
catggatatgatggtcaggggccggaacactcttcggctcgcctggaacgctacctgcag
agttcggccgaaggcaattggcaggtagccaactgttcgacgccagccaactatttccac
gttctgagaaggcaattgacgcgcgatttccgcaagccgctgatcctcatgaccccgaag
agcctccagcggcacaagcggtgcaaatcggatctatcggaattggacgttggcgcgcgg
ttccagcggatactgcgtgatgacagcgagatgggcggcgagagctcgacgaagctggtc
aaggacgccaagatccgcaaggtgctgctgtgctcgggcaaggtctactacgaccttgag
gaggagcgatccaagcgcgcgatcaacgacgtctatctgttgcgtgtcgaacaactctac
cccttcccggctagagcgctggcagcggagctcgcgcggtttcccaccgcgagcatcgtg
tggtgccaggaggagcctaagaacatgggcgcctggtcgtttgtcgaaccctacgtcgaa
tgggccctaagacatgctcgaggaacactggatcggcccgagtacgtcggtcgtccggcg
tctgcatcgacggcgacgggtcagatgtcccggcatctcgctgaggtcggcttgttcatg
gacacggccttcgcaccgtaa

DBGET integrated database retrieval system