KEGG   Rhizobium sp. N1341: AMJ98_PE00368Help
Entry
AMJ98_PE00368     CDS       T04420                                 

Definition
(GenBank) trehalose synthase/alpha amylase protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rhn  Rhizobium sp. N1341
Pathway
rhn00500  Starch and sucrose metabolism
rhn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rhn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMJ98_PE00368
Enzymes [BR:rhn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMJ98_PE00368
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AMJ98_PE00368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 APH hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ANL13592
LinkDB All DBs
Position
pRspN1341e:complement(384868..388149)
Genome map
AA seq 1093 aa AA seqDB search
MDTMNPSSVDPLLWYKDAIIYQLHIKSFYDANGDGVGDFAGLHQKLDHVAALGVNAIWLL
PFFPSPRRDDGYDIADYGNVSPDYGTVEDFRAFVDAAHQRNIRVIIELVINHTSDQHPWF
QRARQAPAGSPERDFYVWSDSDQKFPETRIIFLDTEKSNWTWDAVAGAYYWHRFYSHQPD
LNFDSPLVMEELLKVMRFWLETGIDGFRLDAIPYLVEREGTINENLPETHAILKRIRAAL
DATHPGVMLLAEANQWPEDTREYFGEGDECHMAFHFPLMPRMYMAIAKEDRFPITDILRQ
TPEIPENCQWAIFLRNHDELTLEMVTDAERDYLWETYASDKRARINLGIRRRLAPLMERD
RRRIELMNALLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRTDPA
RLVLPLIADPLYGFEAVNVEAQSTDAHSLLNWTRKMLALRGRHPAFGRGSLRFLSPENRK
ILAYLREYEGETLMCVANLSRLPQAVELDLSAFEGRVPIELTGMSPFPPIGQLTYLLTLP
PYGFFWFQLEADADPPAWRTAPPEQLPDLVTMVIRRGLLDLVDEPRLGRVLSNEILPAYL
AKRRWFGAKDQPLQAARLISATPIPYADGIVLGELEVELPDHSESYQLPLAVAWDDAQPS
ALTQQLALGRVRQGRRVGFLTDGFAIEPMARGILRGLADRSRITGRTGTLEFLGTERLDR
LQVTDDMPVHWLSAEQSNSSLIVGDVAMIKLIRHIFPGVHPEVEMTRFLTCAGYDHTAPL
LGEIAHTDSCGRRSTLIIVQGAIRNQGDAWNWMLNNLRRAADELVLNDPAVEPGDDVFRP
LISFVAMVGTRLGELHVVLSGENADEAFSPVVAGNDEVEAIKKAVAGEVAYAMSKLAERD
ENADPAIDLLARPLLERRSELVELGARLAESARGTLMTRTHGDFHLGQILVSEGDAVIID
FEGEPAKNLAERRAKTVPLRDVAGLLRSLSYLVATAQLDNDAVTEHENEVRRNAIARFGR
NAEQAFLDAYWQAVSASKALAMPTEQRRRVLDAFLLEKAAYEIAYEARIRPKWLPIPLAG
LTEIVSRLVGVRA
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatgaatcccagtagcgtcgacccgctgctctggtacaaggatgcgatcatc
taccagttgcacatcaagtcattctatgacgccaatggcgatggcgtcggcgattttgcc
ggcctgcaccagaagctcgatcacgtcgcagcactcggcgtcaacgccatctggcttttg
cctttctttccctcaccgcgtcgtgacgacggttacgacattgccgactacggcaatgtc
agcccggattacgggaccgtggaggatttccgggctttcgtcgacgccgcccatcagcgc
aacatccgcgtcatcatcgagctcgtcatcaaccacacttccgaccagcatccctggttc
caacgcgcacgccaggcgccggcgggatcgccggaacgggatttctatgtctggtcggac
agcgatcagaaattcccggaaacgcgcatcatcttcctcgacacggagaaatccaactgg
acatgggatgcggtcgccggcgcttactactggcaccgcttctattcccaccagccggac
ctcaacttcgatagcccgcttgtgatggaggagctgctgaaggtgatgcgcttctggctg
gaaaccggcatcgatggtttccgcctcgacgcgatcccgtacctcgtcgagcgcgagggg
acgatcaacgaaaaccttcccgagacccatgcgatcctcaagcgcatccgtgccgctctc
gacgctactcatcccggcgtgatgttgcttgccgaggccaatcaatggcccgaggacacg
cgcgaatattttggcgaaggcgacgaatgccacatggctttccacttcccgctgatgccg
cgcatgtatatggcgatcgccaaggaagaccgcttcccgatcaccgacatcctgcgtcag
acgcctgaaatcccggagaattgccaatgggcgatctttctgcgcaatcatgacgaattg
acgctcgagatggtcaccgacgccgagcgggactatctctgggagacctatgcttccgac
aagcgcgcccgcatcaatctcggcatcaggcgacgcctggcgccgctgatggagcgcgac
cgccggcgcatcgagctgatgaacgcgcttcttctgtcgatgccgggaacgcccgtgatc
tattacggcgatgagatcggcatgggcgacaacatctatctcggcgaccgcgacggggtg
cggacgccaatgcaatggtctcccgaccgcaacggcggcttttcccggacggacccggcg
cgcctcgtcctgccgctgatcgccgatccgctctacggtttcgaagcggtcaatgtcgag
gcccagagcaccgatgcgcattcgctgctcaattggacgcgcaagatgctggcgctgcgt
ggcaggcatccggccttcggacgcggttcgctgcgtttcctttcgcctgagaaccgcaag
atcctggcctatctcagggaatatgagggcgagacgctgatgtgcgtcgcaaacctctcg
cgactgccccaggcggtcgagctcgacctctcggccttcgagggccgcgtgccgatcgaa
ctgacgggcatgtcgccttttccgccgatcgggcaactgacctatctcctgacgctgccg
ccctatggcttcttctggtttcagctggaagcggatgccgatccgccggcatggcgcacc
gcgccgccggaacagcttcccgacctcgttacgatggtgatccgccgcggtctgctcgat
ctcgtcgatgagccgcggttgggacgcgtccttagcaatgaaattctgcccgcttatctc
gccaagcggcgctggttcggggcgaaggaccagccgcttcaggcggctcggctgatctcg
gcaacgccaatcccctatgccgacgggatcgttctcggcgagttggaggtggagctgccg
gatcacagcgaatcctatcagttgccgctggctgtcgcctgggatgatgcgcaaccctcc
gctctgacgcagcagctcgcgctcgggcgggttcgtcagggcaggcgggtcggcttcctg
acggatgggttcgcgatcgagccgatggcgcgcggcattctgcgcgggcttgccgaccgc
tcgcgcattaccggacgtaccggcaccctcgaatttctcggcaccgaacggctcgatcgc
ctgcaggttaccgacgacatgccggttcattggctctcggccgagcaatcgaacagttcg
ctgatcgtcggcgacgtcgccatgatcaagctgatccggcacatttttccgggcgtccat
ccggaggtggagatgacgcggtttctgacctgcgcgggttacgatcacaccgcgccgttg
ctcggcgagatcgcgcacaccgattcctgcggccgccgctcgaccttgatcatcgtccag
ggtgcgatccgtaaccagggcgacgcctggaactggatgctgaacaatttgcgccgtgct
gccgacgagctcgtgctgaacgatccggcagtcgagcctggcgacgacgtcttccggccg
ctgatcagcttcgttgccatggtcggcacgaggctcggcgaattgcatgtcgtcctctcc
ggagaaaacgccgacgaggctttcagtcccgtcgtcgccggtaacgatgaggtcgaggca
atcaagaaggcggtggcgggcgaggtcgcctatgccatgtcgaaactggcagaacgcgac
gagaatgccgatcccgcgatcgatctgctcgcccgccctcttctggaacgccgctccgaa
ctcgtcgaacttggcgcgcgcctggcggagagtgctcggggcacactgatgacgcgcacg
catggcgacttccatctcggccagatcctggtcagcgagggcgatgccgtaatcatcgat
ttcgagggcgaacccgcgaagaacctcgccgaacgccgcgccaagaccgttccgctccgc
gacgtcgccggacttttgagatcgctgagctatctcgtcgccaccgcgcagctcgacaat
gacgcggtcaccgaacatgaaaacgaggtgcgccgtaacgccatcgcccgcttcgggcgc
aatgccgaacaggcttttctcgatgcctattggcaagcggtctccgcatcgaaggcgctc
gccatgccgaccgaacaacgacggagggttctcgatgcctttcttctcgaaaaggccgct
tatgaaatcgcctatgaggcccgcatcaggccgaaatggctgccgatcccgctcgccggc
cttaccgaaatcgtatcgcgcttagtgggggtcagggcatga

DBGET integrated database retrieval system