KEGG   Rhodococcus sp. PBTS 2: A3Q41_01387Help
Entry
A3Q41_01387       CDS       T05030                                 

Gene name
sodA
Definition
(GenBank) Mn superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rhs  Rhodococcus sp. PBTS 2
Brite
Enzymes [BR:rhs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A3Q41_01387 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMY22695
UniProt: A0A143QHR4
LinkDB All DBs
Position
1418418..1419089
Genome map
AA seq 223 aa AA seqDB search
MPASRDGHGVVREGNHVSEYTLPDLDFDYSALEPHISGEINELHHSKHHATYVAGANTAL
EKLAAAREAEDHGSIFLLEKNLAFHLGGHVNHSIWWKNLSPNGGDKPEGELGAAIDDQFG
SFDKFRAQFTAAANGLQGSGWAVLGYDSLGKKLLTFQLYDQQANVPLGIIPLLQVDMWEH
AFYLQYKNVKADYVKAFWNVVNWADVQARFEAATSKTPGLIFP
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcatcacgcgatgggcacggcgtcgttagagaagggaaccacgtgtccgagtac
accttgcccgaccttgatttcgattactccgccctcgagccgcacatctcgggcgagatc
aacgagcttcaccactccaagcatcacgccacctacgtcgccggtgccaacaccgcgctc
gagaagctggctgcagcccgcgaggccgaggatcacggcagcatcttcctgctggagaag
aacctcgcgttccacctcggtggccatgtcaaccactccatctggtggaagaacctgtcg
cccaacggtggcgacaagcccgaaggcgaactcggtgccgcgatcgacgaccagttcggt
tcgttcgacaagttccgcgcacagttcaccgctgctgccaacggcctgcagggctccggc
tgggcagtgctcggctacgactcgctgggcaagaagctcctcaccttccagctctacgat
cagcaggccaacgtgccgctgggcatcattccgctgctgcaggtcgacatgtgggagcac
gccttctacctgcagtacaagaacgtcaaggccgattacgtgaaggcgttctggaacgtc
gtcaactgggccgacgtccaggctcgtttcgaggccgccacgtcgaagaccccgggcctg
atcttcccgtag

DBGET integrated database retrieval system