KEGG   Rhodococcus sp. PBTS 2: A3Q41_02224Help
Entry
A3Q41_02224       CDS       T05030                                 

Gene name
adhT_2
Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rhs  Rhodococcus sp. PBTS 2
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rhs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A3Q41_02224 (adhT_2)
  Lipid metabolism
   00071 Fatty acid degradation
    A3Q41_02224 (adhT_2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    A3Q41_02224 (adhT_2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A3Q41_02224 (adhT_2)
   00626 Naphthalene degradation
    A3Q41_02224 (adhT_2)
Enzymes [BR:rhs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A3Q41_02224 (adhT_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2257708..2258718
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTEFGGPLIVKDIPIPQPAPEQVLVKMETCGVCHTDIHAAQGDWPAKPTLPFVPG
HEGIGVIEAVGSQVSKDRIGERVAIAWLGSACGECDHCVSGWETLCETQQNSGYSIDGAY
AEYAVAHAKYVVHVPDGISSFDAAPLTCAGVTTYKAVKVGGVTPAQRVAIFGVGGLGHMA
VQYAKIAGGFVTAVDIEDEKLDLARELGADHTVNSATTDPVEAIQALGGADVAIVLAVIP
SVFDQAFRSLRRGGRLVCVSMPAHGVFPIPIFETVVGGISVLGSIVGTRKDLREVFALHE
AGRTTVSAVSRKLDEVNDCFDDLMAGRVTARQVLEF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctgttgtcaccgagttcggcgggcccctaatagtcaaggacatcccgata
ccgcagcccgcgcccgaacaggtgctggtgaagatggagacgtgcggtgtgtgtcacacc
gatatccatgctgcgcagggggattggccggccaagccgaccttgcccttcgtccccggg
cacgagggcatcggagtgatcgaggcggtcgggtcgcaggtgtcgaaggacagaatcggt
gaacgggtcgccatcgcgtggctcggttcggcatgtggcgaatgcgatcactgtgtctcg
ggttgggagacgctgtgcgagacgcaacagaacagcggctactcgatcgacggtgcgtac
gccgaatacgctgtcgcccatgcgaagtatgtcgtccatgttcccgacgggatctcctcg
ttcgacgctgccccactgacctgtgccggcgtgaccacgtacaaggctgtcaaggtcggt
ggcgtcaccccggcgcagcgcgtggccatcttcggtgtcggcgggctcggtcatatggcg
gtgcagtacgccaagatcgccggcggcttcgtcaccgcggtcgatatcgaggacgaaaaa
ctcgacctcgcacgagaactcggcgcagaccacaccgtcaactcggcgacgaccgatccg
gtggaggcaattcaggcgctcggtggagccgatgtcgcaatcgtcctggccgtcatcccc
agtgtgttcgatcaggccttccggtcactgcgccgcggcggacggctggtgtgcgtgtcg
atgcctgcgcacggcgtgttcccgatcccgatcttcgagacggtggtcggcggaatctcg
gtcctcggctcgattgtcggcaccaggaaagatcttcgtgaggtgttcgcattgcacgag
gccggacgaacgacggtatcggcggtgtcgcgcaaactcgacgaggtcaacgactgcttc
gacgacctgatggccggacgcgtcaccgctcgtcaggtcttggagttctga

DBGET integrated database retrieval system