KEGG   Rhizobium sp. NT-26: NT26_0669Help
Entry
NT26_0669         CDS       T04765                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain (RuBisCO small subunit)
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00630  Glyoxylate and dicarboxylate metabolism
rht01100  Metabolic pathways
rht01120  Microbial metabolism in diverse environments
rht01200  Carbon metabolism
Module
rht_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:rht00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NT26_0669 (cbbS)
Enzymes [BR:rht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NT26_0669 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: CCF18393
UniProt: L0NBA4
LinkDB All DBs
Position
complement(684702..685091)
Genome map
AA seq 129 aa AA seqDB search
MRITQGTFSFLPDLTDEQISAQVEYCLNNDWAIGVEYTDDPHPRNIYWEMWGNPMFDLKD
AAGVMMEIRACRDAWPEAYIRINAFDSTRGFETVRMSFIVNRPKVEPRLVLTRTEAAGRM
QRYAMNVAQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattacccaaggcaccttttccttcctcccggatcttaccgacgagcagatctcg
gcacaggtcgaatactgcctcaacaacgactgggcgatcggcgtggagtacaccgacgac
ccgcatccccggaacatctactgggagatgtggggcaacccgatgttcgacctgaaggat
gcggccggcgtcatgatggaaatccgggcctgccgcgacgcatggccggaggcctacatc
cgcatcaacgccttcgactccacccgcggcttcgagacggtgcgcatgtcgttcatcgtc
aaccggccgaaggttgagccgcgtctcgtcctgacaaggacggaggccgcggggcgcatg
cagcgctacgcgatgaacgtcgcccagtga

DBGET integrated database retrieval system