KEGG   Rhizobium sp. NT-26: NT26_0761Help
Entry
NT26_0761         CDS       T04765                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rht  Rhizobium sp. NT-26
Pathway
rht00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rht00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NT26_0761 (gst)
Enzymes [BR:rht01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     NT26_0761 (gst)
Transporters [BR:rht02000]
 Other Transporters
  Pores ion channels [TC:1]
   NT26_0761 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: CCF18485
UniProt: L0NBM7
LinkDB All DBs
Position
785218..785841
Genome map
AA seq 207 aa AA seqDB search
MYTLFYSPNACSLASHIALAESGLPYEVRRVNFAENEQRSPEYLKHNPNGRVPALVTEKG
TLIESPAILAFIAQSAPDAKLAPLDDPFEFAQMQGFNSFIASSLHVAYAHNKRGYRWADG
QEALDAMKRKVAPNMRMYFGMVENDFLTGPWVLGEAYSVADPYLFTMADWLEGLGIGREE
FPKVADHYRRMMERPAVQKALSIERPA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtacacgctgttctactcgcccaatgcctgctcgctcgccagccacatcgcgctggcg
gagtccggccttccctacgaggtgcgtcgagtgaatttcgccgagaacgagcagcgttcg
ccggaatacctgaagcataatccgaacggccgcgtgccggcgctggtaacggagaaaggc
acgctgatcgaaagtccggcgatcctcgccttcatcgcccagtcggcacctgacgcaaag
ctcgcgccgctcgacgatcccttcgaattcgcccagatgcagggcttcaacagtttcatc
gcctcatcgctgcacgtggcctatgcccataacaagcgcggctatcgctgggcggatggg
caggaggcgctcgatgccatgaagcggaaggtcgcgccgaacatgcgcatgtacttcggc
atggttgaaaacgacttcctgacaggcccctgggttttgggcgaggcctattcggtcgcc
gacccttacctcttcaccatggccgactggctcgaaggcctcggaatcgggagggaagag
tttcccaaggttgccgaccactatcgccgaatgatggagcgccccgccgtccagaaggcg
ctttccatcgagcgcccggcctga

DBGET integrated database retrieval system