KEGG   Rhizobium sp. NT-26: NT26_0767Help
Entry
NT26_0767         CDS       T04765                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  
DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rht  Rhizobium sp. NT-26
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:rht00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NT26_0767
   03410 Base excision repair
    NT26_0767
   03420 Nucleotide excision repair
    NT26_0767
   03430 Mismatch repair
    NT26_0767
Enzymes [BR:rht01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     NT26_0767
    6.5.1.6  DNA ligase (ATP or NAD+)
     NT26_0767
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     NT26_0767
DNA replication proteins [BR:rht03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    NT26_0767
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     NT26_0767
DNA repair and recombination proteins [BR:rht03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     NT26_0767
   NER (nucleotide excision repair)
    Other NER factors
     NT26_0767
   MMR (mismatch exicision repair)
    Other MMR factors
     NT26_0767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
791917..793563
Genome map
AA seq 548 aa AA seqDB search
MKAFSNLLDRLVLTPSRNGKLKLLADYFRDTPDPDRGYGLAALAGTLDLRNIKPALLREL
VLEKLDPVLFQYSYDYVGDLAETIALVWDGGEKDDTTDEEQPRLGEVVMMMNSLGRTEVR
AAVRDLLDHLDPSSRFAFLKLATGALRIGVSARLAKQALSDMSGPGESQKDVTEIETLWH
GLDPPYEPLFAWLEGRADKPVLATPAIFHSVMLANPVEEGDLEKLDPEAYAAEWKWDGIR
IQMSSYGGTKKLYSRSGDDITGAFPDIVDSINFEGVVDGELLVGGTMRSNSPTRTFSDLQ
QRLNRKTVTSRMLDDYPAFVRAYDLLFQGDEDIRARTFFERRERLGEVIEKAPHDRFDLS
DLVDFSDWQELDRLRVDPPDPVIEGVMIKRKDSAYQAGRLKGPWFKWKRDPYNIDAVMLY
AQRGHGKRSSYYSDFTFGVWAESPDGEQLVPVGKAYFGFTDAELEVLDKFVRDNTVERFG
PVRAVRAEPDFGFVLEVAFEGINRSTRHKSGVAMRFPRISRLRMDKLPRDADRLSTLTAM
IDASMPQS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttctccaacctcctcgaccgcttggtcctgaccccatcgcgcaacggcaag
ctgaagctgctggccgactactttcgcgacacgcccgatccggaccgcggctatggcctc
gcggcactggccggtacgcttgacctgaggaacatcaagccggcgctcctgcgcgaactg
gtgctggaaaagctcgatccggtcctcttccagtattcctacgattacgtcggcgacctc
gccgaaaccatcgcgctcgtttgggatggcggcgagaaggacgacacgaccgacgaggag
cagccgcggctcggcgaagtcgtcatgatgatgaattcgctcggccggaccgaagtgcgc
gccgccgtccgcgacctgctcgaccatctcgatccctccagccgcttcgccttcctgaag
ctcgccaccggggcgcttcgcatcggcgtctccgcccggctcgccaagcaggcgctgtcg
gacatgagcggcccaggggagagccagaaggacgtcaccgaaatcgaaaccttgtggcac
ggcctggatccgccctacgagccgcttttcgcatggctcgagggccgggcggataagccg
gtgctggccacgccggcgatctttcactcggtcatgctggccaacccggtggaggagggc
gatctcgagaagctcgacccggaagcctatgctgccgaatggaagtgggacggcatccgc
atccagatgtcgagctatggcggcacgaagaagctctactcccgctccggcgacgacatc
actggtgccttcccggacatcgtcgactcgatcaacttcgaaggcgtcgtggacggcgaa
ctgcttgttggcggtaccatgcgctccaacagcccgacccgcaccttctccgatctccag
cagcggctgaaccgcaagacggtgacgagccggatgttggacgactaccccgccttcgtg
cgggcctacgacctgctgtttcagggcgatgaggacatccgtgcccgcaccttcttcgag
cgccgcgagcggctgggagaggtcatcgaaaaggccccacacgaccgcttcgacttgtcc
gatctcgtcgacttctccgactggcaggaactcgaccgccttcgggtagatccacccgat
ccggtgatcgagggtgtcatgatcaagcgcaaggacagcgcctaccaggccggtcggctg
aaggggccgtggttcaagtggaagcgcgatccctacaatatcgatgcggtgatgctctat
gcccagcgcggccacggcaagcggtcgagctactattccgacttcaccttcggcgtctgg
gccgagagcccggatggcgagcagcttgtgcccgtgggcaaggcctatttcggcttcacc
gatgctgagctcgaagtgctagacaagttcgtgcgtgacaacacggtggagcgcttcggt
cctgtccgagcggtgcgggcagagccggatttcggcttcgtgctggaggtcgccttcgag
ggcatcaaccgctccacccgccacaagtccggcgtcgcgatgcggtttcctcgcatttcg
cgcctgcgcatggacaagctgccccgcgatgccgaccggctgtcgactctgaccgcgatg
atcgatgcgagtatgccgcagtcgtaa

DBGET integrated database retrieval system