KEGG   Rhodococcus sp. PBTS 1: A3Q40_01642Help
Entry
A3Q40_01642       CDS       T05182                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rhu  Rhodococcus sp. PBTS 1
Pathway
rhu00620  Pyruvate metabolism
rhu00680  Methane metabolism
rhu01100  Metabolic pathways
rhu01120  Microbial metabolism in diverse environments
rhu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rhu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A3Q40_01642 (ppc)
  Energy metabolism
   00680 Methane metabolism
    A3Q40_01642 (ppc)
Enzymes [BR:rhu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A3Q40_01642 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AMY19028
UniProt: A0A143Q8M4
LinkDB All DBs
Position
1772101..1774878
Genome map
AA seq 925 aa AA seqDB search
MTTVDPGLPATEPLREDIRFLGGILGDIVRDHEGPEIFDLVERARVESFRVRRSEIDRSE
LADLFSGIDIARAIPVIRAFSHFSLLANLAEDIHRERRRMVHVRAGEPPQDSSLAATYAK
LDAADLDADRVADLLRDALVAPVITAHPTETRRRSIFETQSRITELMRFRERTELDPAEA
RETEVGIHRQILTLWQTALIRLSRLRIQDEIDVGLRYYDMSLFDVIPTIDARVRDELRRR
WPEANLVPRPVLRPGSWIGGDRDGNPNVTAEVVRTATGRAATVAIEKYLGHLAELERELS
MSARLIDVDDDLQRLADASGDESAYRADEPFRRAVRGLRRRLSRTASRVLDSVPTGALPP
EQVGDAEPYERPQELLADLDVLDHALRVIGDDSIADDRLGTLRRAVDTFGFHLSGLDLRQ
NSEVHESVIAELLAWAGVHADYASLSEDERVAVLSAELETRRPLVGARAEFSEQTAKELA
IVTAAAEAVRRHGPESVPNYIISMCTSVSDMLEAAVLLKEAGILDPGAPGEGPTSSVGVV
PLFETIDDLRGGAATIRATLDVPVYRALVEARGMHQEVMLGYSDSNKDGGYLTANWALYR
AELDLIEAARETGIRLRLFHGRGGTVGRGGGPSYDAILAQPHGAVTGSLRLTEQGEVIAA
KYAEPKSARRNLETLLAATLESTLLDVEGLGDGADAAYAVLDDLADRARAAYGALVHETP
GFVDYFRLSTPVAEIGELNIGSRPASRKPTNSVYDLRAIPWVMSWSQSRVMLPGWYGVGS
AFEGWVGDDQERLRTLSDLYRRWPFFRTVLSNMAQVMAKSDLGLAARYSELVPDEELRRT
VFAMISDEHARTVSWYLKITGHDGLLDDNPALARSVFNRFPYLEPLNHLQVELLRQLRAG
DDREQVKRGILLTMNGLATALRNSG
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgtcgatcccggtttgcccgccacggagccgctgcgcgaggacattcgcttc
ctcggcggcattctcggtgacatcgttcgagaccacgagggtccggagatcttcgatctc
gtcgagcgcgcccgcgtcgagtccttccgggtgcgccggtcggagatcgatcgctcggaa
ctcgccgatctcttctccggaatcgacatcgcgcgcgcaatcccggtcatccgcgcgttc
agccatttctccctgctggccaatctggccgaggacatccaccgcgagcgccgccgcatg
gtgcacgtgcgggccggcgagccgcctcaggacagcagcctggccgccacgtacgccaag
ctcgacgccgccgacctcgacgcggaccgggtggcggatctgctgcgcgacgccctcgtc
gcgcccgtcatcaccgcgcacccgaccgagacccggcggcggagcatcttcgagacgcag
tcccgcatcaccgagctcatgcggttccgggagcggaccgagctcgatccggccgaggcg
cgggagaccgaggtcggcatccatcggcagatcctcacgctgtggcagacggctctgatt
cgcctgtcccgcttgcgtatccaggacgagatcgacgtgggcctgcggtactacgacatg
tccctgttcgacgtcatcccgaccatcgacgcccgcgtccgcgacgagttgcgtcgacgg
tggcccgaggcgaacctggtgccgcgtccggtactgcggccgggatcctggatcggcggc
gaccgtgacggcaacccgaacgtcacggccgaggtggtgcggaccgccacgggccgggcc
gccaccgtggcgatcgagaagtatctcggccacctcgcggagctcgagcgcgagctgtcg
atgtcggcgcgtctgatcgacgtcgacgacgatctgcagcgtctcgccgacgcctccggc
gacgagtccgcataccgtgcggacgagccgttccgccgcgccgtgcgcggtctgcgtcga
cggctctcccgcacggcgtcgcgcgttctggactcggtgccgaccggcgcgttgccgccg
gagcaggtgggcgacgccgagccgtacgagcggccgcaggagctcctcgccgacctcgac
gtgctcgaccacgcgctgcgcgtgatcggggacgacagcatcgccgacgaccggctgggg
accctgcgtcgtgcggtcgacaccttcgggttccacctctccgggttggatctgcggcag
aactccgaggtgcacgagtcggtgatcgccgaactcctcgcctgggccggcgtccacgcc
gactacgcctcgctgagcgaggacgagcgggtggccgtgctgtccgccgagctcgagacc
cggcgtccgctggtcggcgcgcgggcggagttcagcgagcagacggccaaggaactggcc
atcgtcaccgcggcggcggaggcggtgcggcggcacggccccgagtcggtgccgaactac
atcatcagtatgtgtacctccgtcagcgacatgctcgaggccgctgtgctgctcaaggaa
gcgggcatcctcgatccgggcgcaccgggggagggcccgacgtcgtcggtgggcgtggtg
ccgctcttcgagaccatcgacgatctgcgtgggggcgccgcgaccatcagggcgacgctc
gacgtgcccgtgtaccgcgcgctggtggaggcccgcggcatgcaccaggaagtcatgctg
gggtactccgactccaacaaggacggcggctacctcaccgccaactgggcgctgtaccgc
gcggagctggacctgatcgaggccgcccgcgagacgggcatccgactccgtctcttccac
ggtcgcggcggcaccgtgggccgcggcggtggtccgagctacgacgcgatccttgcgcag
ccgcacggtgcggtgacgggttcgctgcgcctcaccgagcagggcgaggtcatcgcggcc
aagtacgccgaaccgaagtccgcccggcgcaacctcgagacgctgctcgcggcgacgctc
gagagcacgctgctcgacgtcgagggcctcggcgacggcgcggacgcggcgtacgccgtg
ctcgacgacctcgcggaccgggcccgtgctgcctacggcgcgctggtccacgagaccccc
ggcttcgtcgactacttccgcctgtcgacgccggtcgcggagatcggcgagctcaacatc
ggctcgaggccggcctcccgcaagcccaccaattccgtgtacgacctgcgcgcgatcccg
tgggtcatgtcctggagccagtcccgcgtcatgttgcccgggtggtacggcgtggggtcc
gcgttcgagggctgggtcggcgacgaccaggagcgcctgcgcaccctctccgatctctac
cgccggtggccgttcttccgcaccgtgctgtcgaacatggcccaggtcatggcgaagtcg
gacctcggcctcgccgcgcgctacagcgagctggtgccggacgaggagctccgtcgcacc
gtgttcgcgatgatctccgacgagcacgcgcgcaccgtgtcctggtacctgaagatcacc
ggacacgacggactgctggacgacaacccggctctcgctcgctcggtcttcaaccgcttc
ccctacctcgagccgctcaaccacctgcaggtggagctgctccggcaactccgtgcgggg
gacgaccgggaacaggtcaagcgcggcatcctgctcaccatgaacgggctcgccactgcc
ttgcgcaacagcgggtag

DBGET integrated database retrieval system