KEGG   Rhizobium sp. N731: AMK02_CH01698Help
Entry
AMK02_CH01698     CDS       T04809                                 

Gene name
tuf-1
Definition
(GenBank) elongation factor Tu 1
  KO
K02358  elongation factor Tu
Organism
rhx  Rhizobium sp. N731
Brite
Translation factors [BR:rhx03012]
 Eukaryotic Type
  Elongation factors
   AMK02_CH01698 (tuf-1)
 Prokaryotic Type
   AMK02_CH01698 (tuf-1)
Mitochondrial biogenesis [BR:rhx03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    AMK02_CH01698 (tuf-1)
Exosome [BR:rhx04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AMK02_CH01698 (tuf-1)
  Exosomal proteins of breast cancer cells
   AMK02_CH01698 (tuf-1)
  Exosomal proteins of colorectal cancer cells
   AMK02_CH01698 (tuf-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ANK85309
LinkDB All DBs
Position
1706937..1708112
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAAVDSYIPTPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGIIKVGEEV
EIVGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALIRGVNRDGVERGQILCKPGSVKPHK
KFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVDVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgagcgcaacaagccgcacgtcaacattggcacgattggccac
gttgaccacggcaagacgtctctgacggcagcgatcacgaagtacttcggtgagttcaag
gcgtacgaccagatcgacgcggctccggaagagaaggcccgcggcatcacgatctcgacg
gcgcacgtcgaatatgagacgccggcccgccactacgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgcggcgcagatggacggcgcgatcctggtt
tgctcggccgctgacggcccgatgccgcagacgcgcgaacacatcctgctcgcccgccag
gtcggcgttccggcgatcgttgtgttcctgaacaaggtcgaccaggttgacgacgccgag
cttctcgaactggtcgagctcgaagttcgcgaacttctgtcgtcctacgacttcccgggc
gacgacattccggtcgtcaagggttcggcgcttgccgctcttgaagattccgacaagaag
atcggcgaagacgcgatccgcgagctgatggcagcggtcgactcctacatcccgacgcct
gagcgtccggttgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgtggtacggtcgtgaccggccgcgtcgagcgtggcatcatcaaggttggtgaagaagtc
gagatcgtcggcatccgtccgacctccaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgaccagggccaggccggcgacaacatcggcgcgctgatccgcggtgtgaac
cgtgacggcgtcgagcgcggtcagatcctgtgcaagccgggctcggtcaagccgcacaag
aagttcaaggcagaagcctacatcctgacgaaggaagagggcggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtgaccggcatcgtgacg
cttccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgacgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgctatccgcgaaggcggccgcacc
gtcggcgccggcatcgtcgcttcgatcgtcgagtaa

DBGET integrated database retrieval system