KEGG   Rhizobium sp. N731: AMK02_CH04015Help
Entry
AMK02_CH04015     CDS       T04809                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rhx  Rhizobium sp. N731
Pathway
rhx00020  Citrate cycle (TCA cycle)
rhx00310  Lysine degradation
rhx00380  Tryptophan metabolism
rhx01100  Metabolic pathways
rhx01110  Biosynthesis of secondary metabolites
rhx01120  Microbial metabolism in diverse environments
rhx01130  Biosynthesis of antibiotics
rhx01200  Carbon metabolism
Module
rhx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rhx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rhx00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMK02_CH04015 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    AMK02_CH04015 (sucA)
   00380 Tryptophan metabolism
    AMK02_CH04015 (sucA)
Enzymes [BR:rhx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     AMK02_CH04015 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ANK87534
LinkDB All DBs
Position
complement(4073541..4076525)
Genome map
AA seq 994 aa AA seqDB search
MARQEANEQFQITSFLDGANAAYIEQLYARYEEDPASVDDQWRTFFKALEDDPADVKKAA
KGASWRRKNWPLAPRGDLVSALDGDWGIVEKAIETKVKAKAEAEGKPADSTDVLQATRDS
VRAIMMIRAYRMRGHLHAKLDPLGIAAAVDDYRELSPENYGFTSADYDRKIFIDNVLGLE
YATIPEMIEILERTYCSTLGVEFMHISNPEEKAWIQERIEGPDKGVAFTAEGKKAILAKL
VEAEGYEQFLDVKFKGTKRFGLDGGESLIPALEQILKRGGHLGLKEAVFGMAHRGRLNVL
SQVMGKPHRAIFHEFKGGSYAPDEVEGSGDVKYHLGASSDREFDGNKVHVSLTANPSHLE
IVDPVVMGKARAKQDMSATVWEGDIIPLSERSKVLPLLIHGDAAFAGQGVIAEILGLSGL
RGHRVAGTMHVIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPILHVNGDDPEAVVYAAKI
ATEFRMKFHKPVVLDMFCYRRYGHNEGDEPSFTQPKMYKVIRGHKTVLQLYAARLVAEGL
LTEGEVEKMKADWRAHLEQEFDAGQSYKPNKADWLDGEWSGLRTADNADEQRRGKTAVPM
KTLKEIGRKLSEIPAGFNAHRTIQRFMENRANMIATGEGLDWAMAEALAFGALCLEGHKI
RLSGQDCERGTFSQRHSVLYDQETEERYIPLANLSPTQARYEVINSMLSEEAVLGFEYGY
SLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSS
ARLERFLQLCAEDNMQVANVTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVSTL
AELAGESAFHRLLWDDAEVIKDGPIKLQKDNKIRRVVMCSGKVYYDLLEEREKRGIDDIY
LLRVEQLYPFPAKALINELSRFRNAEMVWCQEEPKNMGAWSFIDPFLEWVLAHIDAKYQR
VRYTGRPAAASPATGLMSKHLSQLAAFLEDALGG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcaagaagccaacgagcagtttcagatcacctcgtttctggatggcgccaat
gcggcctatatcgagcagctctatgcgcgctacgaagaggatccggcgtcggtcgacgat
caatggcgcaccttcttcaaggcgctggaagacgatcctgccgatgtgaagaaggcggcc
aagggagcatcctggcgcaggaagaactggccgctggcacctcgcggcgatctggtgtcg
gcgctcgacggcgactggggcatcgtcgaaaaggcgatcgagacgaaggtgaaggccaag
gccgaagccgagggcaagcctgccgacagcaccgacgtgctgcaggcgacgcgcgattcc
gtccgcgccatcatgatgatccgcgcctaccgcatgcgcggccacctgcatgccaagctc
gatccgctcggaatcgccgccgccgtcgacgattatcgcgagctgtcgcctgagaattac
ggcttcacatcagccgattacgaccgcaagatcttcatcgacaacgtgctcggcctggaa
tatgcgaccatccccgagatgatcgagatcctcgagcgcacctattgctcgacactcggc
gtcgaattcatgcatatttccaacccggaagagaaagcctggatccaggagcgcatcgaa
ggccccgacaagggcgtggccttcaccgctgaaggcaagaaggcgatccttgccaagctc
gtcgaagccgaaggctacgaacagttcctcgacgtcaagttcaagggcaccaagcgcttc
ggcctcgacggcggcgaatcgctgatcccggctctggagcagatcctgaagcgcggcggt
catctcggcctgaaggaagccgtgttcggcatggcccatcgcggccgcctcaacgtgctc
tcgcaggtcatgggcaagccgcaccgcgccatcttccacgaattcaagggcggttcctac
gcacccgatgaagtcgaaggctccggtgacgtcaagtatcatctcggtgcatcctccgac
cgcgaattcgacggcaacaaggtacacgtgtcgctgacggcaaacccgtcgcatctcgaa
atcgtcgatcccgtcgtcatgggcaaggcgcgcgccaagcaggacatgagcgctacggtg
tgggaaggcgacatcattccgctttccgaacgctccaaggttctgccgctgctgatccac
ggcgatgcggctttcgccggtcagggcgtcattgccgaaatcctcggtctttccggtctg
cgcggccaccgtgttgccggcaccatgcacgttatcatcaacaatcagatcggtttcacg
acgaacccggccttttcgcgctcgtcgccctatccgtccgatgtcgccaagatgatcgaa
gcgccgatcctgcacgtcaacggtgacgatccggaagcggtcgtctacgcagccaagatc
gcgaccgaattccgcatgaagttccacaagcctgtggtgctcgacatgttctgctatcgc
cgctacggccacaatgaaggcgatgagccgtccttcacgcagccgaagatgtacaaggtc
attcgcggccacaagaccgtgctgcagctctatgcggcgcgcctcgtcgccgagggactg
ctcaccgaaggcgaagtcgagaagatgaaggccgactggcgcgcgcatctcgagcaggag
ttcgacgccggccagagctataagccgaacaaggccgattggctggatggcgagtggtcg
ggcctgcgcaccgccgacaatgccgacgagcagcgccgcggcaagaccgcggtgccgatg
aagacgctgaaggagatcggccgcaagctctcggaaataccggcgggcttcaacgcgcac
cgcacgatccagcgtttcatggaaaaccgggccaacatgatcgccaccggcgagggcctc
gactgggcgatggccgaagcgctcgctttcggcgcgctttgcctcgaaggccacaagatc
cgcctgtccggtcaggattgcgaacgcggcaccttctcgcaacgccattcggttctctat
gatcaggaaaccgaggaacgctacattccgctcgccaatctttcgccgacgcaggcccgc
tacgaagtcatcaactcgatgctttcggaagaggccgtgctcggcttcgaatacggctac
tcgctcgcccgcccgaatgcgctgacgctctgggaagcgcagttcggcgatttcgccaac
ggcgcgcaggtggtcttcgaccagttcatctcgtcgggcgaacgcaagtggctgcgcatg
tccggcctcgtctgcctgctgccgcacggctatgaaggccagggcccggagcactcctcg
gctcgtctggaacgcttcctgcagctctgcgcggaagacaacatgcaagtcgccaacgtc
acgacgccggcgaactacttccacatcctgcgccggcagctgaagcgcgacttccgcaag
ccgctgatcctgatgactccgaaatcgctgcttcgccacaagcgggcagtctcgacgctt
gcggaactcgccggcgaatcggctttccatcgcctgctctgggacgatgccgaagtgatc
aaggacggcccgatcaagctgcagaaggacaataagatccgccgtgtcgtcatgtgctcc
ggcaaggtctattacgatcttctggaagagcgtgaaaagcgcggtatcgacgacatctat
ctgctgcgcgtcgaacagctttatcctttcccggctaaggccctcatcaacgagctttcg
cgcttccgcaacgccgaaatggtctggtgccaggaagagcctaagaacatgggcgcatgg
tcgtttatcgaccccttcctcgaatgggtgcttgcccacatcgatgcgaagtaccagcgc
gtccgctataccggccgcccggccgccgcctcgccggcgacgggcctgatgtcgaagcat
ctgtcgcagctcgccgcattcctcgaggatgcattgggcggctaa

DBGET integrated database retrieval system