KEGG   Rhodoferax sp. DCY110: RD110_01905Help
Entry
RD110_01905       CDS       T04721                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
rhy  Rhodoferax sp. DCY110
Brite
Translation factors [BR:rhy03012]
 Eukaryotic Type
  Elongation factors
   RD110_01905
 Prokaryotic Type
   RD110_01905
Mitochondrial biogenesis [BR:rhy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RD110_01905
Exosome [BR:rhy04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RD110_01905
  Exosomal proteins of breast cancer cells
   RD110_01905
  Exosomal proteins of colorectal cancer cells
   RD110_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
409044..410234
Genome map
AA seq 396 aa AA seqDB search
MGKEKFTRTKPHVNVGTIGHVDHGKTTLTAAITTVLAAKFGGSAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLDKYDFPGDDTPIIHGSAKLAME
GDKGELGEGAIMKLADALDTYIPLPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIADTQKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVQRGQVLCKPGS
IKPHTHFTSEIYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPEGKEMVMPGDNVT
ITVKLINPIAMEEGLRFAIREGGKTVGAGVVAKIIA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagaaaagttcacgcgcaccaagccccacgtcaacgtgggcacgatcggccac
gtcgaccatggcaagaccacgctgacggccgccatcacgaccgtgctggccgccaagttc
ggtggttcggccaaggcctatgaccagatcgacgcagcgcccgaagaaaaggcccgcggc
atcaccatcaacaccgcccacgtggaatacgaaacggccaaccgccactacgcccacgtc
gactgccctggccacgccgactatgtgaagaacatgatcaccggcgccgcccagatggac
ggcgcgatcctggtgtgttccgcagccgacggcccgatgccccagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgccttacatcatcgtgttcctgaacaagtgcgacatg
gtcgacgatgccgaactgctcgaactcgttgaaatggaagtgcgcgagctgctcgacaaa
tacgatttccccggcgacgacaccccgatcatccacggcagcgccaagctggccatggaa
ggcgacaagggcgaactcggcgaaggcgcgatcatgaagctggccgatgccctggacacc
tacatccccctgccggaacgtgccgtggacggcgccttcctgatgcccgtggaagacgtg
ttctccatctccggtcgcggtaccgtggtgaccggtcgcgtcgagcgcggcatcatcaag
gtcggtgaagaaatcgagatcgtcggtatcgccgacacgcaaaagaccacctgcaccggc
gtggaaatgttccgcaagctgctcgaccaaggccaggccggcgacaacgtcggtatcctg
ctgcgcggcaccaagcgcgaagacgtgcagcgcggccaagtgctgtgcaagcccggctcg
atcaagccgcacacgcacttcacgtcggaaatctacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgcccgcagttctacttccgcacgacggacgtg
accggcgccatcgaactgccagaaggcaaggaaatggtcatgcctggcgacaacgtgacc
atcaccgtgaagctgatcaacccgatcgccatggaagaaggcctgcgcttcgccatccgt
gaaggcggcaagaccgtcggcgccggcgtggttgccaagatcattgcttaa

DBGET integrated database retrieval system