KEGG   Rhodoplanes sp. Z2-YC6860: RHPLAN_04420Help
Entry
RHPLAN_04420      CDS       T04290                                 

Definition
(GenBank) copper/Zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
rhz  Rhodoplanes sp. Z2-YC6860
Brite
Enzymes [BR:rhz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     RHPLAN_04420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu FlgD_ig
Motif
Other DBs
NCBI-ProteinID: AMN38907
UniProt: A0A140GVA7
LinkDB All DBs
Position
492209..492811
Genome map
AA seq 200 aa AA seqDB search
MRRFSLLVAAALLSTVAVLPASAENLANAQLKDGSGKAVGDVDLVQTQDGVLIKLQLKGI
PAGEHAFHIHAVGKCEAPFNSAGPHFNPANHKHGMMSGEGHAGDMPNLHVPQSGELSVEV
LNTAVTLDKNKPNSLLDADGSALVIHAKADDYKSDPAGNAGDRIACGVIQASGASGATVG
SSPPKNVPAIREKGDAPAKP
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaggttcagtttgcttgtcgcggccgcgctcctttcgaccgttgcggtgctgcct
gcttcggccgaaaacctcgccaacgcgcagctcaaagatggaagcggcaaggcggtgggt
gacgtcgatctggtgcagacccaggacggagtgctgatcaagcttcagctcaaaggcatt
ccggccggcgagcatgccttccatatccacgcggtcggcaagtgcgaggcgcccttcaac
tctgccggcccgcatttcaatcccgccaatcacaagcatggcatgatgtccggcgagggc
catgccggcgacatgccgaacctgcatgtgccccaaagcggcgagctgagcgtcgaggtg
ctcaatacggcagtcacactggacaagaacaagccaaactcgttgcttgacgcggacggt
tcggcgctcgtcatccacgccaaggctgacgactacaagagcgacccggctggcaatgcc
ggcgaccgcatcgcttgcggcgtgatccaggcaagcggtgcctcgggggcgacggtcggc
agttcgcctcccaagaacgtgcctgccataagagaaaaaggcgatgcgcccgccaagcca
tag

DBGET integrated database retrieval system