KEGG   Rhizobium sp. IRBG74: BN877_I0818Help
Entry
BN877_I0818       CDS       T02867                                 

Gene name
gst
Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rir  Rhizobium sp. IRBG74
Pathway
rir00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rir00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BN877_I0818 (gst)
Enzymes [BR:rir01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN877_I0818 (gst)
Transporters [BR:rir02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN877_I0818 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37
Motif
Other DBs
NCBI-ProteinID: CDI07732
UniProt: U4PRG3
LinkDB All DBs
Position
815147..815767
Genome map
AA seq 206 aa AA seqDB search
MFTLFFSPGSCSRASHIVLEESGLPYKAHRVNFAEGEQRSEAFLKINPKGRVPALATESG
VLTETPAILAFIAQMAPEKKLAPLDDPFEFALMQSFNAFISSTVHVAHAHGRRGSRWASK
DSSLEDMKAKVPQTMGECFELIEHGMLRGPWVLGTAYSVADPYLFVMSGWLESDGVDIAR
FPKVHDHFRRMNDRPAVQRALAGERG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgttcacattgtttttctcccccggttcctgctcccgcgccagccatattgtgctggag
gaatcgggcctgccttacaaggcccaccgcgtcaattttgcggaaggcgagcaacgctcc
gaggcatttttaaagatcaatcccaagggccgcgtgccggcactggcgacggaaagcggc
gtgctgacggagacgccggccatcctcgccttcatcgcccagatggcgcccgagaagaaa
ctcgcgccgctcgacgatcccttcgaattcgcgttgatgcagtccttcaacgccttcatt
tcttcgacggtgcatgtcgcccatgcccacggccggcgcggcagtcgctgggcgagcaag
gatagctcgcttgaggatatgaaggccaaggtgccgcagaccatgggtgaatgcttcgaa
ctgatcgagcacggcatgctgcgtggcccatgggttctcggcactgcctattccgtggcc
gatccctatcttttcgtcatgtccggatggctggaaagcgacggcgtggatattgcccgt
ttccccaaggtgcacgaccactttcgccgcatgaacgaccggccggcggtccagcgcgcg
ctcgcgggggagaggggctga

DBGET integrated database retrieval system