KEGG   Rhizobium sp. IRBG74: BN877_II0583Help
Entry
BN877_II0583      CDS       T02867                                 

Gene name
glpD2
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase FAD/NAD(P)-binding (aerobic)
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rir  Rhizobium sp. IRBG74
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rir00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BN877_II0583 (glpD2)
Enzymes [BR:rir01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BN877_II0583 (glpD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
linear:complement(593705..595249)
Genome map
AA seq 514 aa AA seqDB search
MSSENIFDLFVIGGGINGCGIARDAVGRGYSVALAEKGDFASGTSSAATKLIHGGLRYLE
HYEFRLVREALMEREILWAMAPHVIWPMRFVLPIQKGGVRPAWMVRLGLFLYDNLGGRKL
LPATRTLDLRKDPAGKPLKPAFARAFEYSDGWVDDARFVVLNARDAANRGAMIMNRTRVV
SARREGGLWLIETLDEKTGRAGVHKARMLVNAAGPWVDTVLSGVFGRKDVHNVRLVQGSH
VIVRRKFSDPRAYFFQNPDNRIIFAIPYERDFTLIGTTDRDYKGDPAKVRISEEEISYLC
NAASDYFSEPVRPEDIVWTYSGVRPLFDDGASKAQEATRDYVLKVEEGNGQAPLLNIFGG
KLTTYRRLAEHALEKIGAAIGEKGKPWTAGSHLPGGDFGAERYETQVRALVSRYPFLDRH
HAERLVRNYGTKAAELLGGVTDAVGLGRHFGGTLYECEVRWLVEQEWACTAEDILWRRTK
QGLRLNKAEAAELDDFVSKLTGGRKEAEAAVERA
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcgaaaacatttttgatctttttgtcatcggcggcggcatcaatggctgcggc
attgcccgtgatgcggtgggcaggggttattccgtggcgcttgcggaaaaaggcgatttc
gcttccggcacgtcgtccgccgccaccaagctcatccatggcggcctgcggtatctcgaa
cattacgagtttcgtctggtgcgcgaggcgctgatggagcgggaaattctctgggccatg
gcaccgcatgtcatctggcccatgcgtttcgtcctgcccattcagaagggcggggtgcgc
ccggcctggatggttcggcttggcctgtttctttatgacaatctcggcggccggaaactt
ttgccagccacccgaacgctcgatctgcggaaggacccggctggaaagcctctgaagccg
gcttttgccagggccttcgaatattccgacggttgggtggatgatgcccgtttcgtggtt
ctcaatgcgcgcgatgccgctaatcgcggcgcgatgatcatgaaccgcacgcgggtcgtt
tccgcacgacgcgaaggtgggctatggctcatcgaaactctggacgaaaaaaccggccgt
gcgggcgtgcacaaggcacgtatgctggtgaacgccgctggtccctgggtggatacggtg
ctttccggcgtcttcgggcgaaaggatgtgcataatgtccggctcgtgcagggcagccat
gttatcgtgcgccggaagttttccgatccgcgcgcctatttcttccagaaccctgacaac
cgcatcatcttcgccattccctatgagcgggatttcaccctgatcggcaccacggatcgc
gactacaagggcgatccggccaaggttcgcatttccgaagaagagatttcctatctctgc
aacgccgccagcgactatttcagcgagccggttcggccggaagacatcgtctggacctat
tccggcgtgcggccgctctttgatgatggtgcttcgaaagcgcaggaagccacacgcgat
tacgtgctgaaggttgaggagggcaacgggcaagctccactcctcaatattttcggcggc
aagctcaccacctatcgacggctggcggaacatgcgttggaaaagatcggcgcggcgatc
ggcgagaagggcaagccatggacggcgggctcacacctgccgggcggagatttcggcgcg
gagagatatgagacgcaggtgcgggcgcttgtctcccgatatcctttcctcgatagacac
catgccgagcggctagtcagaaactacggtacgaaggctgcggaattgttgggcggcgtt
accgatgccgtcgggctcggccggcatttcggcggcacgctctatgaatgcgaggtgcgc
tggctggttgagcaggaatgggcctgcacggccgaggacattctctggcgacgcacgaaa
cagggccttcgcctgaacaaggccgaggccgccgagctggatgacttcgtatccaagctg
acgggtggaaggaaagaggcggaagctgcggtggagcgagcctga

DBGET integrated database retrieval system