KEGG   Rhizobium sp. IRBG74: BN877_II0995Help
Entry
BN877_II0995      CDS       T02867                                 

Gene name
nrtB
Definition
(GenBank) nitrate transport permease protein (nrtB)
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
rir  Rhizobium sp. IRBG74
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:rir00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    BN877_II0995 (nrtB)
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BN877_II0995 (nrtB)
Transporters [BR:rir02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    BN877_II0995 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
linear:1022680..1023573
Genome map
AA seq 297 aa AA seqDB search
MSALARKFNEEPQQQAAKKASVVALAPKQSPRIDLRKWAVVAARNIIPPFVVLAILLAVW
QLLCSAPGASLPPPSQVFEESYDLIVSPFFHNGSQDIGLGLRVLVSLERVAYGFGLAAIA
GIILGAVIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAQVLRLNQLEFFFKIMLPSAAPYIFTGLRIGIGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGVVGFMLDKLVAALGKVITRGAAAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcattggcccgaaaattcaacgaagagccgcagcagcaggcagcgaagaaggca
agtgtcgtggcgcttgcgccgaaacagtcgccgcggattgatctgcgcaaatgggctgtg
gtagcggcccgcaacatcatcccaccgtttgtcgttctcgccattctgcttgctgtctgg
cagctgctctgttccgcccccggcgcctccctgccgccgccgagccaggttttcgaggag
agctacgatctcatcgtatcgccgttcttccataatggctcgcaggatataggtctcggc
ctgcgcgtgctggtctcgctggagcgggtggcctacggtttcggccttgccgccatcgcc
ggcatcattctcggggctgtcatcggccagtcggtctgggcgatgcgcggcctcgatccg
atctttcaggtgctgcgcaccgtgccgccgctcgcctggctgccgctttcactggccgcc
tttcaggacagcaatccgtcggccattttcgtgatcttcatcacctccatctggccggtc
atcatcaataccgcagtcggcgtgcggaacattccgcaggattaccgcaacgtggcgcag
gtgctgcggctgaaccagctcgaattcttcttcaagatcatgctgccatcggcagcaccc
tacatcttcaccggcctgcgcatcggcatcggcctttcgtggctcgcgatcgtggcggcg
gaaatgctgaccggcggcgtcggtatcggcttcttcatctgggatgcgtggaattcctcg
cgcctgcccgacatcatcgtggcactcgcctacatcggcgtcgtcggcttcatgctcgac
aagctggtggcggcgctcggcaaggtcatcacccgcggcgctgcggccaactga

DBGET integrated database retrieval system