KEGG   Rhizobium leguminosarum bv. trifolii WSM1689: RLEG3_20895Help
Entry
RLEG3_20895       CDS       T03009                                 

Definition
(GenBank) phosphoribosyl-AMP cyclohydrolase
  KO
K01496  
phosphoribosyl-AMP cyclohydrolase [EC:3.5.4.19]
Organism
rlb  Rhizobium leguminosarum bv. trifolii WSM1689
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rlb00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    RLEG3_20895
Enzymes [BR:rlb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     RLEG3_20895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2115476..2115928
Genome map
AA seq 150 aa AA seqDB search
MSQLIFNQPSEDKSALEDAGDFTPRFDDRGLITAIVTDAGDGELLMVAHMNAQALALTIQ
TGTAHYFSRSRGKLWKKGDTSGNLQTVKEIRTDCDQDAIWLKVEVAGHDATCHTGRRSCF
YRTITLRDGKPMLDIVDDELHFDPQDVYGK
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaactgatcttcaatcaaccatccgaggacaagtcggcgttggaagacgccggc
gatttcacgccgcgcttcgacgaccgtggcctgatcacggcgatcgtcaccgacgccggc
gacggcgagctgctgatggtggcgcatatgaatgctcaggcgctggcgctgaccatccag
accggcacggcgcactatttcagccgttcgcgcggcaagctctggaagaagggcgacacc
tcgggcaatctccagacggtgaaggaaatccgcaccgattgcgatcaggacgccatctgg
ctgaaggtcgaggtcgccggccacgacgccacctgccacaccggccgccgctcctgcttc
taccggacgatcacgcttagagacggaaaaccgatgctggatatcgtcgacgacgagctt
catttcgatccgcaggatgtctacggaaaatag

DBGET integrated database retrieval system