KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0903Help
Entry
Rleg_0903         CDS       T00926                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rleg_0903
Enzymes [BR:rlg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rleg_0903
Transporters [BR:rlg02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rleg_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C
Motif
Other DBs
NCBI-ProteinID: ACS55200
JGI: Rleg_0903
UniProt: C6AS25
LinkDB All DBs
Position
893844..894464
Genome map
AA seq 206 aa AA seqDB search
MLTLYYAPGTCALASLIALEESGLAFEVKKISLRDGEQRSPDYLKINPKGRVPALVTDYG
VLTETPAILAYIAQSAPAAKLAPLDDPFEFARLQSFNSYICSTVHVNHAHRPRGSRWADE
PAAIEAMKAKVPQNMVDCFTLIEQTMFEGPWVMGEAYSLADPYLFVMTDWLPSDGVDPAR
FEKASDHHARMLQRPAVQRALAYDRA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgacactatactacgctccgggaacctgcgcgctcgcaagccttattgccctggaa
gaatccggcctggccttcgaagtcaagaagatcagcctccgcgatggcgagcagcgctcg
ccggattatctgaagatcaacccgaagggccgggtgccggcactggtcaccgattatggc
gtgctgacggaaacgccggcgatcttggcctatatcgcccagagcgcgccggccgccaag
ctggcgccgcttgacgatcctttcgagtttgccaggctgcagtccttcaacagctatatc
tgctcgaccgtgcatgtgaaccatgcgcatcgcccgcgcggctcgcgctgggcggacgag
ccggcggccatcgaggcgatgaaggccaaggtgccgcagaatatggtcgattgtttcacg
ttgatcgagcagacgatgttcgaaggcccatgggtgatgggcgaagcctattcgctcgcc
gatccctatctcttcgtcatgaccgactggctgccgtcggacggcgtcgatcccgcccgc
ttcgaaaaggcgagcgaccaccacgcccgcatgctgcagcgccccgccgtccagcgggcg
ctggcctacgatcgggcctga

DBGET integrated database retrieval system