KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0966Help
Entry
Rleg_0966         CDS       T00926                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Brite
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Rleg_0966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACS55261
JGI: Rleg_0966
UniProt: C6ASL2
LinkDB All DBs
Position
951296..951898
Genome map
AA seq 200 aa AA seqDB search
MAFELPELPYDYEALAPFMSKETLEFHHDKHHKAYVDNGNKLAAEAGLSDLSLEDVVKKS
FGTNAGLFNNAAQHYNHIHFWKWMKKGGGGNKLPGKLEAAFTSDLGGYDKFKADFANAGA
TQFGSGWAWVSVKNGKLEISKTPNGENPLVHGATPILGVDVWEHSYYIDYRNARPKYLEA
FVDSLINWDYVLERYEEATK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattgcctgaacttccctatgactacgaagcgcttgctcccttcatgtcg
aaggaaacgctggagttccaccacgacaagcaccacaaggcctatgtcgacaacggcaac
aagctcgccgccgaagccggtctttcggacctctcgctcgaagacgtcgtcaagaagtcc
ttcggcaccaatgccggcctcttcaacaacgcggcccagcattacaaccacatccatttc
tggaagtggatgaagaagggcggcggcggcaacaagctgccgggcaagctcgaagcggcc
tttacctccgatctcggcggctatgacaagttcaaggccgatttcgccaatgccggcgcc
acccagttcggctccggctgggcctgggtttccgtcaagaacggcaagctcgaaatctcc
aagaccccgaacggcgaaaacccgctcgttcacggcgccaccccgatcctcggcgtcgac
gtctgggaacactcctactacatcgactatcgcaacgcccgcccgaagtacctcgaagcc
ttcgtcgacagcctgatcaactgggactacgtcctggaacgctacgaagaagccacgaag
taa

DBGET integrated database retrieval system