KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_6460Help
Entry
Rleg_6460         CDS       T00926                                 

Definition
(GenBank) nitrate ABC transporter, inner membrane subunit
  KO
K15577  
nitrate/nitrite transport system permease protein
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Nitrogen metabolism
ABC transporters
Module
Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Rleg_6460
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Rleg_6460
Transporters [BR:rlg02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Rleg_6460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
pR132505:complement(178336..179229)
Genome map
AA seq 297 aa AA seqDB search
MSALANKEIPSTSASAKLAAKVLPFSGKHGSRIDFRRAALTALRNVVPPVVVLALILLVW
QVLCSSADASLPSPHRVWLDSYDLIAYPFFNYGSQDIGLGWRVLISLQRVLYGFGLAAVT
GVIIGAIIGQSVWAMRGLDPIFQVLRTVPPLAWLPLSLAAFQDSNPSAIFVIFITSIWPV
IINTAVGVRNIPQDYRNVAEVLRLNQFEFFWKIMLPSAAPYIFTGLRIGVGLSWLAIVAA
EMLTGGVGIGFFIWDAWNSSRLPDIIVALAYIGIVGFALDKLVAALGKLITRGAMAN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccctggcaaataaagaaattccctcaacgtctgcctccgccaagctggcggca
aaggttctgccattttccggcaagcatggatcgcggatcgattttcgtcgagcggcactg
accgcacttcgcaacgtcgttccgccagtcgtcgtgctggcactcatcctgctcgtctgg
caggtgctctgctcatcggcggatgcgtctttaccctcgccgcatcgggtctggctggat
agttatgacctgatcgcctatccgtttttcaactatggctcccaggatatcgggctcggc
tggcgcgtgctcatttcgctgcagcgcgttctctatggctttgggcttgccgcggtcacc
ggcgtcataatcggtgcgatcatcggccagtcggtctgggcaatgcgtggcctcgatccg
atcttccaggtgctgcgtacggttccgccgctcgcctggctgccgctgtcgctcgcagcc
ttccaggattccaatccttcggcgatcttcgtgatcttcatcacttcgatctggccggtg
atcatcaacaccgccgttggcgtccgcaatatcccgcaggattaccgcaatgtcgccgag
gtgctgcggctcaaccagttcgagtttttctggaagatcatgctgccttcggcagcgcct
tacatcttcaccggcctcaggatcggcgtcggcctttcctggctcgccatcgtcgcggcc
gaaatgctgacgggtggcgtcggcatcggcttcttcatctgggacgcatggaactcgtcg
cgccttccggacatcatcgtcgcgctcgcctatatcggcatcgtcggcttcgccctcgac
aaactggtggcagcactcggcaaactcatcacgcgcggcgccatggccaactga

DBGET integrated database retrieval system