KEGG   Roseobacter litoralis: RLO149_c039420Help
Entry
RLO149_c039420    CDS       T01572                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rli  Roseobacter litoralis
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rli00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RLO149_c039420
Enzymes [BR:rli01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RLO149_c039420
Transporters [BR:rli02000]
 Other Transporters
  Pores ion channels [TC:1]
   RLO149_c039420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3993159..3993743
Genome map
AA seq 194 aa AA seqDB search
MYTVIGPVKSRAMRVLWMLEELGEAYNHIDAAPRSDEARTYNPSGKVPALIDGAEVLTDS
MAILTYLADKHGKLTAPAGTVARARQDAMTFWLVDEFDAILWAAAKHSFVLPQEHRVPAV
KDSLKAEFSASADQLAAKLNGPFLMGDHLTVPDILACHCLNWAVGAGFPRVDDKLFAYGK
NLRQRPAFQAAAAR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtatacggttatcggccccgtcaaatcccgcgccatgcgcgtcctctggatgctcgaa
gaactgggcgaggcttacaatcacatcgacgccgcaccccggtccgacgaggcgcgcaca
tataacccatccggtaaggtgcccgcgctgatcgacggcgcggaggtgctcaccgattcg
atggcaatcctcacctatctggcggataaacacggcaagctcaccgcaccggcgggcaca
gttgcgcgggcgcggcaggacgcgatgaccttctggctggtagacgaattcgacgcgatc
ctctgggcagcagcaaaacacagttttgtcttgccgcaggaacaccgcgtaccggcggtc
aaagactccctcaaggcagagttcagcgcatccgccgatcaactggccgcaaaactcaat
gggccgtttctgatgggcgatcaccttacggttccggacattctcgcctgtcattgcctg
aactgggccgtcggtgctggattcccgcgcgtggatgacaaactattcgcctatggcaaa
aacctccgccaacggcccgcgtttcaggcagctgctgcgaggtaa

DBGET integrated database retrieval system