KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_07035Help
Entry
RLEG12_07035      CDS       T03015                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RLEG12_07035
Enzymes [BR:rlu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     RLEG12_07035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
unnamed:688092..689606
Genome map
AA seq 504 aa AA seqDB search
MGREIHDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSGATKLIHGGLRYLEH
YEFRLVRESLMEREILWAMAPHIIWPLRFVLPYHKGGIRPAWLIRLGLFLYDHLGGRKLL
PATSVLDMRRDPAGKPLKALFAKAFEYSDGWVDDARMVVLNARDAADKGATIMPRTKVVS
ARRENGLWHIETTDTVTGRNDSHQARMLVNAAGPWVDHVIRSAFGQNEAHHVRLVQGSHI
IVKKKFDDPRAYFFQNPDNRIIFAIPYEGEFTLIGTTDRDYTADPRDVRISEEETVYLCN
AASEYFKEPVRPEDIVWTYSAVRPLYDDGASKAQEATRDYVLKLEGEGSAAPLLNVFGGK
LTTYRRLSEHALEKIGAAIGVKGAPWTAKSHLPGGDFPVKGYEAEVAKLKRRYAFLADQH
ARRLVRRYGTKAEALLGDARATEDLGRLFGGDLYEAEVKYLVEHEWARHGEDVLWRRTKD
GLRLSQEQAQSLEEYMAAIPAMAG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggccgggagattcacgacatattcgtcatcggcggcggcatcaacggctgcggcatc
gcgcgcgatgccgtcgggcgcggttattccgtggcgctggcggagatgaacgatttcgcc
tcgggcacctcgtcgggcgccaccaagctcattcatggcggcctacggtatctcgagcat
tatgagttccgcctcgtgcgtgaatcgctgatggagcgcgagatcctctgggcgatggcg
ccgcacatcatctggccgctgcgcttcgtgctgccctaccacaagggcggtatccgcccg
gcctggttgatccgcctcggcctcttcctctacgaccatctcggcggccgcaagctgctg
ccggcgacctccgtgctcgacatgcgccgcgatccggctggcaagccgctgaaagcgctg
tttgccaaggccttcgaatattccgacggctgggtcgacgatgcccgcatggtggtgctg
aacgcccgcgacgccgccgacaagggagcgacgatcatgccgcgcaccaaggtggtgtcg
gcaaggcgcgaaaatggcctgtggcatatcgagacgaccgatacggtcaccgggcgcaat
gacagccatcaggccagaatgctggtcaatgccgccggtccctgggtcgatcatgtcatc
cgttcggcctttggccagaacgaggcgcatcacgtccgcctcgtccagggcagccacatc
atcgtcaagaagaagttcgacgatcccagagcctatttcttccagaatcccgacaaccgt
atcatcttcgccatcccctatgagggcgaattcacgctgatcggtaccaccgaccgggat
tacaccgccgatcccagggatgtccggatctccgaggaggagaccgtctatctttgcaat
gcggcatcggaatatttcaaggagccggtcaggcccgaggatatcgtctggacctattcg
gcggtcaggccgctttatgacgatggcgcttcgaaagcgcaggaagcgacgcgcgattac
gtgctgaagctggagggcgaggggagtgccgcgccgctgctcaacgtcttcggcggcaag
ctcaccacctatcgccggctttccgagcatgcgctggaaaagatcggtgccgcaatcggc
gtcaagggcgccccgtggacggcaaaaagccatctgccgggcggcgatttcccggtcaag
ggttacgaggctgaggtcgccaagttgaaacggcgctatgcgttccttgccgaccagcat
gcgcgccggctggtgcgccgctacggcacgaaggccgaggcgctgctgggcgatgcccgt
gcgaccgaggatctcggacggttgttcggcggcgatctctacgaggccgaagtcaaatat
ctcgtcgaacatgaatgggcccggcacggcgaagacgtgctgtggaggagaacaaaggat
ggtctgcgcctttcccaggagcaggctcagtcactggaggagtacatggctgccataccg
gcaatggccggataa

DBGET integrated database retrieval system