KEGG   Rhizobium leguminosarum bv. trifolii CB782: RLEG12_17760Help
Entry
RLEG12_17760      CDS       T03015                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
rlu  Rhizobium leguminosarum bv. trifolii CB782
Brite
Translation factors [BR:rlu03012]
 Eukaryotic Type
  Elongation factors
   RLEG12_17760 (tuf)
 Prokaryotic Type
   RLEG12_17760 (tuf)
Mitochondrial biogenesis [BR:rlu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RLEG12_17760 (tuf)
Exosome [BR:rlu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RLEG12_17760 (tuf)
  Exosomal proteins of breast cancer cells
   RLEG12_17760 (tuf)
  Exosomal proteins of colorectal cancer cells
   RLEG12_17760 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AHG44969
LinkDB All DBs
Position
1292980..1294155
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERNKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEEKARGITIST
AHVEYETPARHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSSYDFPGDDIPVVKGSALAALEDSDKK
IGEDAIRELMAAVDAYIPTPERPIDQPFLMPIEDVFSISGRGTVVTGRVERGIVKVGEEV
EIVGIRATSKTTVTGVEMFRKLLDQGQAGDNIGALVRGVNRDGVERGQILCKPGSVKPHK
KFMAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVTVAVEL
IVPIAMEEKLRFAIREGGRTVGAGIVASIVE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagagtaagtttgagcgcaacaagccgcacgtcaacatcggcacgatcggccac
gttgaccacggcaagacgtctctgacggcagcgatcacgaagtacttcggtgagttcaag
gcgtacgaccagatcgacgctgctccggaagaaaaggcccgtggcatcaccatttcgacg
gcccacgtcgaatatgagacgccggcccgccactacgcgcacgtcgactgccccggccac
gccgactacgtcaagaacatgatcaccggtgctgcccagatggacggcgcgatcctggtg
tgctcggccgctgacggcccgatgccgcagacgcgcgaacacatcctgctggcccgccag
gtcggtgttccggcgatcgtggtgttcctgaacaaggtcgaccaggttgacgacgccgag
cttctcgaactggtcgagctcgaagttcgcgaactgctgtcgtcctacgacttcccgggc
gacgatatcccggtcgtcaagggttcggcactggccgctctcgaagacagcgacaagaag
atcggcgaagacgcgatccgcgagctgatggctgcggtcgacgcctacatcccgacgcct
gagcgcccgatcgaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgtggtacggttgtgaccggccgcgtcgagcgtggcattgtcaaggttggcgaagaagtc
gagatcgtcggcatccgcgcgacctcgaagacgacggtgaccggcgttgaaatgttccgc
aagctgctcgatcagggccaggccggcgacaacatcggcgcactggttcgcggtgtgaac
cgtgacggcgtcgagcgtggccagatcctgtgcaagccgggctctgtcaagccgcacaag
aagttcatggccgaagcctacatcctgacgaaggaagagggtggccgtcatacgccgttc
ttcaccaactaccgtccgcagttctacttccgcacgacggacgtcacgggcatcgtaacg
ctgccggaaggcacggaaatggtcatgccgggcgacaacgtcacggttgccgtcgagctg
atcgttccgatcgcgatggaagaaaagctgcgcttcgccatccgcgaaggcggccgcacc
gtcggcgccggtatcgttgcttcgatcgtcgagtaa

DBGET integrated database retrieval system