KEGG   Rattus norvegicus (rat): 117185Help
Entry
117185            CDS       T01003                                 

Gene name
Neu3
Definition
(RefSeq) neuraminidase 3
  KO
K12357  
sialidase-2/3/4 [EC:3.2.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    117185 (Neu3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    117185 (Neu3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     117185 (Neu3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
1q32
AA seq 418 aa AA seqDB search
MEEVSSCSLRSTLFQQEEQNRITYRIPALLYIPPTHTFLAFAEMRTSSRDEDAVYLVFRR
GVMKGCSVEWGPQQPLMEATLPGHRTMSPCPVWEKNTGRVYLFFICVQGHVSERWQLLWG
RNAARLCFLYSEDSGCSWGEVKDLTEEVVGSEMKHWATFAVGPGHGIQLQSGRLLIPAYA
YLISCWFLCFPCSVKPHSLMFYSDDLGVTWHCGKFIKPQVTGECQVAEVPGKAGNLVLYC
SARTPNKFRAEAFSTDSGDCFQKPTLNQQLCEPRGGCQGSVVSTRPLKMPYTCQDSSGKD
VPSTQKCPLMDRSLEVEEGAGAPSGTWLLYSHPTNKKKRMNLGIYYNQNPLEVNYWSRPW
ILNRGPSGYSDLAVVEGQGLFACLFECGERHEDEKIDFCLFSDQEVLSCDDCTSPSSN
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagtttcatcctgctccctccgcagcactctgttccagcaggaagaacagaac
aggattacctaccggatcccagcactgctgtacattcctcccacccacaccttcctggcc
ttcgcagagatgcgtacctcaagcagagatgaggatgctgtctacctggtgttcagacga
ggggtgatgaaggggtgctctgttgagtggggcccccaacagccactgatggaggccaca
ttacctgggcatcgcaccatgagcccctgccctgtgtgggagaagaatactggccgtgta
tacctgtttttcatctgcgtgcagggccatgttagtgagcgctggcagcttctgtggggc
aggaatgctgcccgtctctgcttcctttacagtgaggactctgggtgctcgtggggtgaa
gtgaaagatttgactgaggaagtcgttggctcagagatgaagcactgggccacgtttgct
gtgggcccaggtcatggcatccagctgcagtcggggaggctgctcattcccgcctatgcc
tacttgatatcatgctggtttctctgctttccatgttcagtcaagccccattccctaatg
ttctacagtgatgacttaggagtcacatggcactgtggcaagttcattaagccccaggtg
acaggggagtgccaagtggcagaagtgcctgggaaggctggtaaccttgtgctctactgc
agtgcccgaacaccaaacaaattccgagcagaggcttttagcactgatagtggtgactgc
tttcagaaaccaaccctgaaccaacaactctgcgagcctcgtggtggctgccaaggtagt
gtagtgagcacccggcctttgaagatgccatacacatgtcaagactcaagtggtaaagat
gttccctctactcagaaatgccctctgatggacagatctctggaggtggaggaaggagct
ggagcaccatcagggacatggctcttgtactcacatccaactaacaagaagaagagaatg
aacctaggcatctactacaaccaaaaccccttggaggtgaactactggtcccgcccgtgg
atcttgaaccgtgggcccagtggctactctgacctggctgtggtagaaggacagggcttg
ttcgcgtgcttatttgagtgtggggagaggcatgaggatgagaagattgacttttgtctg
ttttcagaccaagaggtcctgagctgtgacgactgtaccagccctagtagcaactaa

DBGET integrated database retrieval system