KEGG   Rattus norvegicus (rat): 24380Help
Entry
24380             CDS       T01003                                 

Gene name
Gad2, gad65
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00250  Alanine, aspartate and glutamate metabolism
rno00410  beta-Alanine metabolism
rno00430  Taurine and hypotaurine metabolism
rno00650  Butanoate metabolism
rno01100  Metabolic pathways
rno04727  GABAergic synapse
rno04940  Type I diabetes mellitus
Module
rno_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    24380 (Gad2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    24380 (Gad2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    24380 (Gad2)
   00430 Taurine and hypotaurine metabolism
    24380 (Gad2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    24380 (Gad2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    24380 (Gad2)
Enzymes [BR:rno01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     24380 (Gad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase COG7
Motif
Other DBs
NCBI-GeneID: 24380
NCBI-ProteinID: NP_036695
RGD: 2653
Ensembl: ENSRNOG00000018200
UniProt: Q05683
LinkDB All DBs
Position
17q12.3
AA seq 585 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDSEKPAESGG
SVTSRAATRKVACTCDQKPCSCPKGDVNYALLHATDLLPACEGERPTLAFLQDVMNILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILTHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGSGDGIFS
PGGAISNMYAMLIARYKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDERGKMIPSDLERRILEVKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIW
MHVDAAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQ
MHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAHIDKCLELAEY
LYNIIKNREGYEMVFDGKPQHTNVCFWFVPPSLRVLEDNEERMSRLSKVAPVIKARMMEY
GTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atggcatctccgggctctggcttttggtccttcggatctgaagatggctctggggatcct
gagaacccgggaacagcgagagcctggtgccaggtggcccaaaagttcacgggcggcatc
ggaaacaagctatgcgctctgctctacggagactctgagaagccagcagagagcggcggg
agcgtgacctcgcgggccgccactcggaaggtcgcctgcacctgtgaccaaaaaccctgc
agctgccccaaaggagatgtcaattatgcacttctccacgcaacagacctgctgccagcc
tgtgaaggagaaaggcccactctcgcatttctgcaagatgtaatgaacattttgcttcag
tacgtggtgaaaagttttgatagatcaactaaagtgattgatttccattaccccaatgag
cttcttcaagagtataattgggaattggcagaccaaccgcaaaatctggaggaaattttg
acgcactgccaaacaactctaaaatatgcgattaaaacagggcatccccgatattttaat
cagctgtctaccggattggatatggttggattagcagcagattggttgacatcaacagca
aacacgaacatgtttacctatgagatcgcccctgtatttgtactactggaatatgtgaca
ctaaagaaaatgagggaaatcattggctggccaggaggctctggcgatggaatcttttct
cctggtggtgccatctccaacatgtacgccatgctcattgcccgctataagatgtttcca
gaagtcaaggaaaaggggatggcggcggtgcccaggctcatcgcattcacgtcagagcat
agtcacttttctctcaagaagggagctgcagccttggggatcggaacagacagcgtgatt
ctgattaaatgtgatgagagagggaaaatgatcccatctgaccttgaaagaagaatcctt
gaagtcaaacagaaaggatttgttcctttcctggtgagtgccacagctggaaccactgtg
tacggggcttttgatcctctcttggctgtagctgacatctgcaaaaaatataagatctgg
atgcatgtggatgctgcttggggtggagggttactgatgtctcggaaacacaagtggaag
ctgaacggtgtggagagggccaactctgtgacatggaatccccacaagatgatgggtgtc
cccttgcaatgttcggctctcctggtcagagaggagggactgatgcagagctgcaaccag
atgcatgcttcctacctctttcagcaagataagcactatgacctgtcctatgacacggga
gacaaggccttgcagtgtggacgccacgtcgatgtctttaaattatggctcatgtggaga
gcaaaggggactactggatttgaagctcacattgataagtgtttggagctggcagagtat
ttatacaatatcattaaaaaccgagaaggatatgaaatggtgttcgatgggaagcctcag
cacacaaatgtctgcttctggtttgtacctcctagtttgcgagttctggaagacaatgaa
gagagaatgagccgcctctcaaaggtggcgccagtgattaaagccagaatgatggagtat
gggaccacaatggtcagctaccaacccttaggagataaggtcaacttcttccgcatggtc
atctcaaaccctgcagcaactcaccaagacattgacttcctcattgaagaaatcgaacgc
ctgggacaagatttgtaa

DBGET integrated database retrieval system