KEGG   Rattus norvegicus (rat): 316013Help
Entry
316013            CDS       T01003                                 

Gene name
Setd2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    316013 (Setd2)
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     316013 (Setd2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     316013 (Setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 316013
NCBI-ProteinID: NP_001101659
RGD: 1305576
Ensembl: ENSRNOG00000020915
UniProt: D4A5H6
LinkDB All DBs
Position
8q32
AA seq 2294 aa AA seqDB search
MKSVPESLELDMKQDIVSNSLEEHTNQTLKEQADNALQKEDSHIGKEEEVSDGSKISLSS
KKASSKKKSSQFEGTFLGSESDEDSVRTSSSQRSHDLKSSTSIEKERDFKKSSAPSKSED
LGKSSRSKTERDDKYFSYSKLERDTRYVSTRCRSERDRRRSRSRSRSDRVSRTSLSYSRS
ERSHYYDSERRYHRSSPYRERTRYSRPYTDNRARESSDSEDEYKKTYPRRTSAHSYRDLR
TSSSYSKFDRDCKTETSYLEMERRGKYSSKLERESKRTSEHEAIKRCCSPPNELGFRRGS
SYSKHDNNSTSRYKSALSKSISKSDKFKNSFCCTELNEENKQSHSFSLQTPCSKGSELRT
INKIPEREKTGSPSPSNQLNDSPTFKKLDESPILKPEFIGHDSHESIKELELPKMKNDQL
RNFCSIELNVNGSPETETDVATFRTSKPDAISMTSDDSVTGSEVSPLIKGCVLSSNGFQS
VGRCRERDADDACRQHNKSKSPFRETEPLLSPHHDKVMSLPVKTIDYSKTLIKEPVDKRH
SCCKTKDSDRYCSPNESSEAENREISSNCFVNVHLDSKTVVCDNRELTDQHSEFTCDGYK
QSIGSTSSASLNHFDDLYESVGSSGISSLQSLPSGIRCEENTSPALDTVQSKKGIDFLKY
VGKETDVVSALPDSGKAFSSWENRHNMLSGQSLQESQEEGSSTLHERRGRSEVSLDEEEQ
RGHTHISDDSEVVFPYDLNLTMEDSDGVTYTLKCDSSGNAPEIVSTVHGDYSASSASSSD
ESDSEDTESDDSSIPRNRLQSVVVVPKNSTLPMEETSPCSSRSSQSYRHYSDHWEDGLES
RRHAYEEKFESMASKGCSQTEKFFLHKGTERNPETSYSQFSRKIDNHLPEIAHSQSDGVD
STSHTDVKSDSVGHLNSEDAIRAKMSRPQELPVYCDDFEDLPNTSRQQMIFSNRPDSSRL
GKAELSFSSSCDISRMDGLHSSEELRNLGWDFSQQERPTTTYQQPDSSYGTCGTHKYQQS
AEHYGGTHDYWQGNGYWDPRSAGRPPGTGVVYDRIQGQVPDSLTDDREEEENWDQRSGSH
FSSPSNKFFFHQKDKGSVQAPEISSNSIKDSLVINERKDFSKNFEKNDIKERGPPKKRRQ
ELESDSESDGELQARKKVRVEIEQGQSSVPQHSELVGPSCAMDDFRDPQRWKEFAKLGKM
PCYFDLIEENVYLTERKKNKSHRDIKRMQCECTPLSKDERAQGEVACGEDCLNRLLMIEC
SSRCPNGDYCSNRRFQRKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDHKEF
KARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVG
FFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERS
RKKDSVDGELEALMENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKS
FLERHGLSLLWIWMAELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPIIQRWSQ
TKTAVPQLSEGDGYSSENTSRAHTPLNTPDPSAKPSTEVDTDTPKKLIFRRLKIISENSM
DSAVSDVTSELECKDGKEDLDQLETVTVEEDEELQSQQLLPSQLCESKVESESTIDVSKL
PISEPEADTETEPKDSNGTKLEETIAEETPSQDEEEGVSDVESERSQEPPDKTVDISDLA
TKLLDSWKDLKEVYRIPKKSQTEKESTVTERGRDTAAFRDQTAPKTPNRSREREPDKQSQ
NKEKRKRRGSLSPPSSAYERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVA
QREAQKQQQQMQNLGMTSPLPFDSLGYNASHHPFAGYPPGYPMQAYVDPSNPNAGKVLLP
TPSMDPVCSPAPYDHAQPLVGHSTESLAAPPSVPVVPHGAASVEVSSSQYAAQSESVVHQ
DSSVPGMPVQTPGPVQGQNYSVWDSNQQSVSVQPQYSPAQSQATIYYQGQTCSTVYGVTS
PYSQTTPPIVQSYAQPSLQYIQGQQIFTAHPQGVVVQPAAAVTTIVAPGQPQPLQPPEMV
VTNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDAS
LEHEAEMDLGTPTYDENPMKTSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYR
KPDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQK
FGAVYKPKEDTELE
NT seq 6885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgtaccagaatctttagagttggatatgaagcaagatattgtatctaacagt
ttggaagaacacacaaatcaaactttgaaggaacaagcagataatgccctgcaaaaagaa
gattcccatattgggaaggaagaagaggtttcagatggctctaagataagcctcagttct
aaaaaagcaagttctaagaagaaatcttcacaatttgaaggtacatttcttggttcagaa
tctgatgaagattctgtacggacttcctccagtcaaagatcacatgatttaaaatcttca
acaagcattgagaaagaaagagattttaagaagagctcagcaccttcaaaaagtgaggat
ttgggaaaatcatcaagatctaaaacagagagagatgataaatactttagctactcaaaa
cttgaaagagacactcggtatgtatctactcgatgtaggtctgaaagagatcgaaggcga
agccgatctcgttctagatctgacagagtctctagaactagtttgtcttattctcggtca
gaaagatctcattattatgattctgaacgccgttaccataggagttccccttatcgtgag
aggacacgctattctcggccatatacagataacagggcacgggagagctcagactctgaa
gacgagtataagaagacatatccaaggcgtacctcagcccactcctacagagacctaagg
acatcatcatcttactctaaatttgatcgggactgtaaaactgagacctcttacttagaa
atggagagaagaggaaagtattcttcaaaactagaaagagaatccaaacggacttcagag
catgaagccataaaaagatgttgttctcccccaaatgaattgggattccgacggggatca
tcatattccaagcatgataacaacagtacttcccgttataaatctgccctttcaaaatct
atatctaagtctgataaatttaaaaattctttctgttgtacagaattaaatgaggaaaac
aaacaatctcattcttttagtttgcagacgccttgttcaaaaggtagtgaattaagaaca
attaataaaattcctgaaagagaaaagactgggtctccatctccatcaaatcaattaaat
gattcacctacttttaaaaagctagatgaatctcctattcttaagcctgaatttatagga
catgatagccatgagagtattaaagaattggagttaccaaaaatgaaaaatgatcaattg
agaaatttttgttccattgaattaaatgtaaacggatctccagagacagaaactgatgtg
gcaacatttcgaacttctaaaccagatgctatctcaatgacttctgatgatagtgtgact
ggatcagaggtatcccctttgatcaagggttgcgtgctttcatcaaatggatttcagagt
gttggtagatgcagagaaagggatgcagatgatgcttgtaggcagcataataaatcaaaa
agtccatttagggaaacggaacctttgttgtcaccacaccatgataaagtcatgtctttg
ccagttaagactatagattattccaaaacgttaattaaagagccagttgataagagacat
tcttgctgcaaaaccaaagattcagatagatactgttctccaaatgaaagctctgaagct
gaaaatagggagatttcttcaaattgctttgtgaatgtgcatttggattccaaaacagtt
gtctgtgataatagggagctgacagaccagcactcagaatttacgtgtgacggatataag
cagagcattggtagcactagctcggcctctcttaaccattttgatgacttgtatgagtct
gtagggagttcaggtatttcatctctccagagtcttccatcaggaataagatgtgaagag
aacacgtctccagctctagacacagtgcagagtaaaaaaggtatagattttttaaagtat
gtagggaaagagacagatgttgttagtgcccttcccgattcaggaaaagcattttcttct
tgggaaaacaggcataatatgttgtctgggcagtctttgcaagagtctcaagaagaaggg
agttccacattgcatgagagaagaggaagatcagaagtctccttagatgaggaagaacaa
aggggtcatacacatatttctgatgattcggaagttgtatttccttatgatttgaactta
accatggaagacagtgatggtgtaacttacaccttaaaatgtgacagcagtggtaatgct
cccgagattgtatcaactgtccatggagattactctgcgtcttctgcaagttcaagcgat
gagagtgattcagaagatacagagtctgatgacagcagtattccgagaaaccgtctccag
tctgttgtggttgtgccaaagaattctactttgcccatggaagagacaagtccctgctct
tctcggagcagtcagagctacagacattattccgaccactgggaggatgggttagagtcg
aggagacatgcgtatgaggaaaagtttgagagtatggcaagtaaaggctgttcccaaact
gaaaagttctttcttcataaaggaacagagaggaatccagaaacatcttattcacaattc
agcaggaagatagataatcacctgcctgaaattgctcattctcagagtgatggggttgat
agtacaagtcatacagacgtgaagtctgactctgtaggtcacctgaattcagaagacgca
ataagagccaaaatgtccaggccacaagagctcccagtctattgtgatgactttgaagac
ctcccaaatacgtctcggcagcagatgattttctccaatcggccagatagtagtagacta
ggaaaagccgagctgagtttttcttcctcttgtgacatttcccgaatggatggcttgcac
tcatcagaagagctcagaaacctagggtgggacttttcccaacaagaaaggcccaccacc
acataccagcagcctgacagcagctatggaacttgtggtacacacaagtatcaacagagt
gccgagcattacggtgggacccatgattactggcaaggcaatggctattgggatccaagg
tcagcaggtagacctccaggaactggggttgtttatgatcgaatccaagggcaagtacca
gattctctaacagatgatcgtgaagaagaggaaaattgggatcaacgaagtggatcacat
ttttcaagcccatccaataaatttttcttccatcagaaggacaagggatcagtgcaagca
ccagaaataagcagcaattcaattaaagactctttagttataaacgaaaggaaagatttt
tcaaaaaacttcgaaaaaaatgatataaaagagcgaggacctcctaaaaaacgaaggcaa
gaattggagagtgattctgaaagtgatggtgagctacaggctagaaagaaagttagagtg
gagatagaacagggacagtcgtctgtgccccagcactcagagctggtggggccttcgtgt
gctatggatgacttcagggacccgcagcggtggaaagagtttgccaagctggggaagatg
ccttgttactttgatctgattgaagaaaatgtttatttaacagaaaggaagaagaacaaa
tcccatcgggatattaagcggatgcagtgtgagtgcacacctctttctaaagatgaacga
gctcaaggtgaagttgcctgtggagaggattgccttaatcgtctcctcatgattgaatgt
tcctctcgatgtccaaatggagattattgttcgaacagacggtttcagagaaaacagcac
gcagatgtagaagtcatacttacagaaaagaaaggctggggcttaagggccgccaaggat
cttccttcgaacacctttgtcctggaatactgcggagaggtacttgatcataaagagttt
aaagctcgggtgaaggaatatgcgcggaacaaaaacatccactactatttcatggccctg
aagaatgatgagataatagatgccactcagaaagggaactgctctcgttttatgaatcat
agctgtgaaccaaactgtgaaacccaaaaatggactgtgaatggacagctgagggttgga
ttttttaccaccaaattagttccttcaggctcagaattaacgtttgattaccagttccaa
cgatatggcaaggaggctcagaagtgtttctgtggatcagcgaactgtcggggttacttg
ggaggagaaaacagagtcagtatcagagctgcaggggggaagatgaaaaaggaacgctct
cgaaagaaggattcagtggatggagaacttgaagcactgatggaaaatggtgaaggcctc
tctgataagaaccaagttcttagtttatcccggctcatggttagaatcgaaactttggaa
cagaagcttacctgtctcaagcttattcagaacacacactcacagtcctgtctcaagtca
tttctggaacggcatgggttgtcactgttgtggatctggatggcagagctcggcgatggc
cgggaaagtaaccagaagcttcaggaagagattataaagactttggagcatttgcccatt
cctactaaaaatatgttggaagaaagcaaagtacttccaattattcaacgctggtctcag
actaagactgctgttcctcagttaagtgaaggagacgggtattctagtgagaatacatca
cgtgctcacacaccgcttaatacaccggacccttctgccaagccgagcacagaggtggat
acagatactcccaagaaactcatatttcgcagactaaagattataagtgaaaatagcatg
gacagtgcagtctcagacgtcaccagtgagctagaatgcaaggatggcaaagaggacctg
gatcagttagagactgtcactgtggaggaagatgaagaactgcagtcccaacagctcctg
ccatcacaactctgcgagtccaaagttgagagtgaaagcaccatcgacgtcagtaaatta
cccatatctgaaccggaggctgacactgagaccgagcccaaagacagcaatggcacaaaa
ctagaagaaactattgccgaggaaacaccatcccaagatgaggaagagggtgtgtctgat
gttgagagtgagagaagccaggaaccaccagataaaacagtggatataagtgatttggct
accaagctactagacagttggaaagatctaaaggaggtatatcgaattccaaagaaaagt
caaaccgaaaaggagagcacagtaactgaacgagggagggacactgctgccttcagagat
caaacagctccaaagacccctaacaggtcgagagagagagagccagacaagcagtctcaa
aataaagagaaaaggaaacgccggggctcgctgtcaccaccttcttctgcgtatgaacgg
ggaacaaaaaggccagatgacaggtatgatacaccaacttctaaaaagaaagtacgaatt
aaagaccgaaacaaactttctacagaggagcgcaggaagttgtttgaacaagaggtagca
caaagggaggctcagaagcaacagcaacagatgcagaacttggggatgacatcaccacta
ccctttgactctctgggttataatgcctctcatcacccctttgctgggtacccaccaggt
tatcccatgcaagcctatgtggatcccagcaaccctaatgctggaaaggtgcttctgcct
acacctagcatggaccctgtgtgctcccctgcgccttatgatcacgctcagcccttggta
ggacattctacagagtctcttgctgcccctccgtctgtgccagtggtaccacacggggca
gcctccgtggaagtttctagttcacagtatgcagctcagagtgaaagtgtggtgcatcaa
gactccagtgtccctggaatgccagtacaaactccaggcccagtccaaggacagaattac
agtgtctgggattcaaaccaacagtctgtcagtgtacagccccagtattctcctgcccaa
tctcaagcaaccatatattaccaaggacagacatgttcaactgtctacggtgtgacctct
ccttattcacagacaactcctccaattgtgcagagttatgcccagccaagtcttcagtat
atccagggacagcagattttcacagctcacccacaaggagtggtggtacagccagctgca
gccgtgactacaatagttgcaccagggcagcctcagcccttacagccacctgaaatggtt
gtaacaaataatctactggatctgccaccgccctcccctccaaaaccaaaaacgattgtt
ttacctcccaactggaagacagcccgagatcctgaagggaagatctattactaccacgta
atcacgagacagactcagtgggatcctcctacctgggaaagcccaggagatgatgccagc
cttgagcatgaagctgagatggacctgggaaccccaacctatgatgaaaaccccatgaag
acatcaaaaaagcccaagacagcagaagcagacacctccagtgagctggcaaagaaaagc
aaagaagtattcagaaaagagatgtctcagttcattgtccagtgcctgaatccttaccgg
aaacctgactgcaaggtggggaggatcacgacgactgaagatttcaagcacctcgcgcga
aagctgactcatggagtcatgaacaaggagctgaagtactgtaagaaccctgaggacctg
gagtgcaacgagaatgtgaaacacaaaaccaaggagtacatcaagaagtacatgcagaag
tttggggctgtttacaaacctaaagaggacactgaactagagtga

DBGET integrated database retrieval system