KEGG   Rattus norvegicus (rat): 60335Help
Entry
60335             CDS       T01003                                 

Gene name
Tgm1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     60335 (Tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
LinkDB All DBs
Position
15p13
AA seq 824 aa AA seqDB search
MEGPRSDVGRWGRSPWQPTTPSPEPEPEPEPDRSSRSRRGGGRSFWARCCGCCSCGNRAD
DDWGPEPSGSRSRGTSSRGGGSRGGDSRGRDSRGGRRPESRGSGVNAAGDGTIREGMLVV
NGVDLLCSRSDQNRREHHTDEFEYDELILRRGQPFHIILFLNREYESSDRIALELLIGNN
PEVGKGTHVIIPVGKGGSGGWKAQVTKTNGHNLTLRVHTSPNAIIGKFQFTVRTRSEAGE
FQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQ
FDHGVLDACLYILDRRGMPYGGRGDPVSVSRVVSAMVNSLDDNGVLIGNWTGDYSRGTNP
SAWVGSVEILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLT
MDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCC
GPCSVESIKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAI
NSNMREDITHIYKHPEGSEAERKAVEKAAAHGSKPNVYATRDSAEDVAMQVEAQDAVMGQ
DLTVSVVLTNRGSSRRTVKLHLYLCVTYYTGVSGPTFKETKKEVVLAPGASDTVAMPVAY
KEYKPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIV
FKNPLPITLTNVVFRLEGSGLQRPKVLNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDS
PQLSQVHGVIQVDVAPSSGGRGFSEAVGDSRSGENIPMAFRGGA
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atggaaggtcctcgctcagacgtgggccgctggggtaggagcccctggcagcccacgaca
ccgtcgccagagccagagccagagccagagccagacagaagctcgcgctcccgccgagga
ggaggccgctccttctgggctcgctgttgtggctgctgctcctgcgggaacagagctgat
gatgactggggacccgaaccttctggctccagaagccgagggaccagctcccggggtgga
ggctcccggggtggggactctcggggtagggactctcgaggtggccgaagacctgagtct
cggggcagtggtgtgaatgcagctggagatggcaccatccgagagggaatgctggttgtg
aatggtgtagatctgctgtgctcgcgatcagaccagaaccgccgagagcaccacaccgat
gagtttgaatatgacgagctaattttgcgccgtgggcagcccttccacataatcctcttc
ctgaaccgggagtatgagtcctctgatcgcattgcccttgagcttctcatcggaaacaat
cctgaggtgggcaagggcacccacgtgatcatcccagtgggtaagggaggcagcggtggc
tggaaggcccaagtgactaagaccaatggacacaacctaaccctgcgcgtccacacctcc
cctaatgccatcattggcaagtttcaattcactgtccgtacacgctcagaggctggcgag
ttccagctgccctttgacccccgcaatgagatctacatcctcttcaatccctggtgtcca
gaggacatagtgtatgtggaccacgaagactggcgacaagaatatgtgcttaatgagtct
ggaagaatctactatgggacagaagcacagattggcgaacggacctggaattatggccag
tttgaccatggggtgctggatgcctgcctgtacattctggatcggagggggatgccatat
ggaggtcgcggggacccagtcagtgtctctcgggtcgtctctgccatggtgaactccctg
gatgacaatggagttctgattgggaactggactggcgactactctcgaggcaccaatccc
tcagcgtgggtgggcagtgtggagatcctgcttagctacctacgcaccggctattccgtc
ccctatggccaatgctgggtctttgccggtgtgaccaccacagtgctccgatgtctgggc
cttgctacccgtactgtcaccaacttcaactctgcacacgacacggacacgtccctcact
atggacatttattttgatgagaacatgaagccactggagcacctgaaccacgattctgtt
tggaacttccacgtgtggaacgactgctggatgaagaggccagatctgccctcaggcttt
gatgggtggcaggttgtggatgccacaccccaggagaccagcagtggcatcttctgctgt
ggcccctgttcagtggagtccatcaagaatggcttagtctacatgaagtatgacacacct
ttcatttttgccgaggtaaacagtgataaggtatactggcagcggcaggatgacggcagc
ttcaagatcgtgtatgtggaagagaaagccattggcacactgattgtcacaaaggcgatc
aactccaacatgcgagaggacatcacccacatctataagcacccagaaggctcagaagca
gagaggaaggctgtggaaaaggctgcggcccatggcagcaaacctaatgtgtatgccacc
cgggactctgctgaggatgtggcaatgcaggtggaggcacaggatgctgtgatggggcag
gatctgactgtctctgtggtgttgaccaatcgtggcagtagccgacgcactgtgaagttg
cacctctacctttgtgtcacctactacactggtgtctctgggcctaccttcaaggagacc
aagaaagaagtggtattagccccaggagcctcggacactgtggccatgcctgtggcctac
aaggaatacaagccccaccttgtggaccagggggcaatgttgctcaatgtctcaggccat
gtcaaggagagtgggcaggtactagccaagcaacacaccttccgtttgcgcaccccagac
ctctctctgacattactgggagctgcagtagttggccaggaatgtgaagtccagatcgtg
ttcaagaaccccctgcctatcaccctcaccaacgttgtcttccggctcgaaggttctggg
ttacagagacccaaggtcctcaatgttggggacatcgggggtaacgagacggttacactg
cgccagacatttgttcctgtgcgaccaggcccccgccagctcattgccagtctggacagt
ccacagctttcccaagtacacggtgtcattcaagtggatgtggccccatcctctggaggc
agaggtttctcagaggctgtaggtgacagtcgctccggggagaacatacctatggcattt
cgaggtggagcttag

DBGET integrated database retrieval system