KEGG   Rhodococcus opacus PD630: Pd630_LPD01705Help
Entry
Pd630_LPD01705    CDS       T03071                                 

Definition
(GenBank) Putative aldehyde dehydrogenase dhaS
Organism
roa  Rhodococcus opacus PD630
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1794132..1795580)
Genome map
AA seq 482 aa AA seqDB search
MTDYDKLYIGGKWVAPATDQVLEVFSPATEERVGSCPVASPADIDDAVATARRAFDEGPW
PRTTPAERGEILAKAAKLIEERGDALNALISSEMGQPPAMVGMMQQTPSLATLNFYAGLA
NEFEWEQTRTGAFGQTKVLREPVGVVAAVLAWNVPLFLAVNKLSPALLAGCTVLLKPAPE
SPLSTHLLAEIFAEAGVPEGVISVLPGGAETGEYLVSHPGIDKITFTGSSPVGRKIGAIA
AQNLKRCSLELGGKSAAIILEDADLASTMPMLVMSGLMNTGQACVAQTRILAPRSRYDEV
LDALVAGAGFMTVGDPSDPAAQLGPLISEKQRDRVEGYIAKGKEQGARVVLGGGRPEGLD
KGWYVEPTIFADVDNSMTIAREEIFGPVLSVIPYDSEDEAIKIANDSDYGLAGSVYTTDI
DHGLAVAKQIRTGTYAINWYAFDPGSPFGGYKASGIGRENGPEGLEAFCETKSVLMPPGY
SG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactacgacaagctctacatcggcggcaagtgggtggccccggccaccgatcag
gtgctcgaagtgttctccccggccaccgaggaacgcgtcggcagctgtcccgtcgcgtcg
ccggccgacatcgacgacgccgtcgcgacggcccggcgcgcattcgacgaaggcccgtgg
ccgcggacgactcccgccgagcgcggggagatcctcgccaaggcggcgaaactcatcgag
gaacgcggcgacgccctcaacgcgctgatctcgtccgagatgggccagccgcccgcgatg
gtcgggatgatgcagcagacgccgtcactcgcgaccctgaacttctatgccggtctcgcg
aacgaattcgagtgggagcagacccgcaccggcgcgttcgggcagacgaaggtgctgcgg
gagccggtcggcgtggtggccgcggtcctcgcctggaacgtgccactgttcctcgccgtc
aacaagctgtccccggcgctgctcgccggctgcaccgtcctgctcaagcccgcacccgaa
tccccgctctccacacaccttctcgccgagatcttcgccgaggcgggtgtccccgagggt
gtcatctccgtcctgcccggcggcgccgagaccggcgaatacctggtgtcgcatcccggg
atcgacaagatcacgttcaccggcagcagtcccgtcggccgcaagatcggggccatcgcc
gcgcagaacctcaagcgctgctccctcgaactgggcggcaagtcggcggccatcatcctc
gaggacgccgacctcgcgtccacgatgccgatgctggtgatgtccgggctcatgaacacc
gggcaggcatgcgtcgcgcagacccggatcctcgccccgcgttcccgctacgacgaggtc
ctcgacgccctcgtggcgggtgccggattcatgaccgtcggcgatccgtccgacccggcc
gcgcaactcggtccgctgatctccgagaagcaacgcgaccgcgtcgagggctacatcgcc
aagggcaaggaacagggcgcccgcgtggtgctcggcggcggccgtccggaaggcctcgac
aagggctggtacgtagagccgacgatcttcgcggacgtcgacaactcgatgacgatcgcc
cgcgaggagatcttcggacccgtcctgtccgtgattccctacgactccgaggacgaggcg
atcaagatcgccaacgactccgactacggactcgccggctcggtgtacaccaccgatatc
gatcacggtctcgccgtcgcgaagcagatccgcaccggcacctacgccatcaactggtac
gcattcgacccgggatcaccgttcggcggctacaaggcctccggcatcggtcgggagaac
gggccggaggggctcgaagcgttctgcgagaccaagtccgtcctcatgccgcccggctac
agcggatag

DBGET integrated database retrieval system