KEGG   Rhodococcus opacus PD630: Pd630_LPD07487Help
Entry
Pd630_LPD07487    CDS       T03071                                 

Definition
(GenBank) Aldehyde dehydrogenase, thermostable
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
roa  Rhodococcus opacus PD630
Pathway
roa00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:roa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pd630_LPD07487
Enzymes [BR:roa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Pd630_LPD07487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AHK34672
UniProt: W8H953
LinkDB All DBs
Position
7774581..7776047
Genome map
AA seq 488 aa AA seqDB search
MTTPAHLHHLVDGQWLAGAGDTVVSTSPAEPDVVVAQGRLADTAALDGAVAAAQRVKREW
ARTPAHERGAILVRAAGIVENAAQDWGTELAREEGKTKPEGIGEVLRAAQILRYYGNDAD
RDAGEVFSSPRRGERILVTRKPIGVVGVITPFNFPIAIPAWKIAPALTYGNTVVWKPAST
VPLLAMRLTQALTDAGLPNGVLNLVIGDRTVGNGLVEHPGIDAITFTGSTGVGRRIAAAG
AARGVPVQAEMGGKNAAVVLGDADLELAAEQVMFGAFRSTGQKCTATSRLIVTDDIAEDF
LAELGKRADTLNVGNPVQDGTEMGPVVDAAARTSIRLGIERAIEQGALPIAGGHEYSEGS
LAAGHFVPPTILELPSPATDIWREELFGPVLAVRRAGSVDDAFALANDSEFGLSAAIFTQ
DLTRTLDAIDDIDVGILHINSESAGADPHVPFGGAKKSGYGPKEQGRSAREFFTHTTTVY
LRGGQATI
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaccacacccgcacacctgcaccatctcgtcgacggacaatggctcgccggcgctggc
gataccgtcgtcagcaccagtccggccgagccggacgtcgtcgtcgcccagggacgactg
gcagacactgcggcactcgacggggccgtcgcggcagcccaacgggtcaagcgagagtgg
gcgcgtacccccgcgcacgagcggggcgcgatcctcgtgcgtgccgcgggcatcgtggag
aacgccgcccaggactggggcaccgaactcgcccgcgaagaaggcaaaaccaagcccgaa
ggcatcggcgaggtactgcgcgcggcccagatcctgcgctattacggtaacgacgccgac
cgcgacgcaggcgaggtgttctcctcgccgcgcagaggtgaacgcatcctggtcacccgc
aaacccattggcgtggtgggtgtgatcacccccttcaactttccgatcgccatcccggcg
tggaagatcgccccggccctgacctacggcaacaccgtggtctggaaaccggccagcacg
gtgccgctcctggcgatgcgcctgacccaagccctcaccgacgcgggcctgcccaacggc
gtgctgaacctggtgatcggtgaccggaccgtcggcaacggtctcgtcgaacatccgggc
atcgacgcgatcacgttcaccggctccaccggggtcggccgcaggatcgccgcggccggc
gccgcccgcggggtcccggtgcaggcggagatgggcggcaagaacgccgccgtcgtcctc
ggcgatgccgacctcgagctggccgccgaacaggtgatgttcggtgccttccgctcgacc
gggcagaagtgcaccgcgacctcccggctgatcgtcaccgacgacatcgccgaggacttc
ctcgccgaactcggcaaacgcgccgacaccctgaacgtgggtaaccccgtccaggacggc
accgagatggggccggtggtcgacgcagccgcccgcacctcgatccggctcgggatcgag
cgtgccatcgagcagggggcgctgccgatcgccggcggccacgaatactccgagggctcc
ttggctgcagggcatttcgtcccgccgacgattctcgagctgccttcgcccgccactgat
atctggcgtgaggaattgttcggtcccgttttggcggtccggcgagcaggaagcgtcgac
gacgccttcgccctcgcgaacgacagcgaattcggtctttctgccgccatcttcacccag
gacctcacccgcacactggacgccatcgacgatatcgacgtcggcatcttgcacatcaac
tccgaatccgccggcgcggacccccacgtcccgttcggcggcgcgaagaagagcggatac
ggtccgaaggagcagggccgctcggcgcgggagttcttcacccacaccaccacggtgtac
ctgcgcggtgggcaggcgacgatatga

DBGET integrated database retrieval system