KEGG   Rhodococcus opacus B4: ROP_62400Help
Entry
ROP_62400         CDS       T00882                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
rop  Rhodococcus opacus B4
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ROP_62400 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ROP_62400 (alr)
Enzymes [BR:rop01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ROP_62400 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:rop01011]
 Precursor biosynthesis
  Racemase
   ROP_62400 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
6843505..6844707
Genome map
AA seq 400 aa AA seqDB search
MTLAEAVPADDHGHSEPAAPAQAAAPQAEAVVDLDAIAHNVRILRDSARGAAMMAVVKAD
GYNHGAVAVARAALAAGASELGVTTVSEALTLRRAGIDAPVLAWLHTVDADFAPAIAADV
ELGVSSPRHLAAVVAAARRVGTPAIVTMKVDTGLNRNGVAPDELAQVLVDLARAQAEGSV
RLRGIFSHLAHADEPHHAWIDSQRDRLVDAIADAKRHGLVPEVVHLSNSAATLTRPDLRF
DMVRPGIAIYGLSPVPELGQFGLRPAMTLRSRVALVKKVAAGEGVSYGHQWVAPRDTTVA
LLPLGYADGLPRSLSGRFEVQLGAERRPGIGRVCMDQVVVDLGPDGGGVREGDTAVFFGN
GDLGEPIAQEWADKLDTIHYEVVTGVRGRTVRTYVGGTGT
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttgctgaagcagtaccggcggacgaccacggacacagcgagcctgcagctccc
gcgcaggcggcggcaccgcaggccgaggcagtggtggatctggatgcgattgcgcacaac
gtccggatcctgcgggacagcgcccggggcgcggcgatgatggccgtcgtgaaggcggac
ggctacaaccacggcgcggtagccgtggcccgcgcggcgctggccgcgggagcgtcggaa
ctgggtgtgacgacggtgtcggaggctctcacgctgcgccgggcgggcatcgacgcgccc
gtcctcgcgtggctgcacaccgtcgatgccgatttcgcccccgcgatcgcggccgacgtc
gaactcggcgtctcctcgccccgccacctcgccgcggtggtggctgcggcgcggcgcgtc
ggcaccccggcgatcgtcacgatgaaggtcgacaccggcctgaaccgcaacggggtggcg
cccgacgaactggcgcaggtcctcgtcgacctggcgcgcgcgcaggccgagggctcggtg
cggctgcgcggcatcttctcgcatctggcccacgccgacgaaccgcatcacgcctggatc
gactcccagcgggatcggctggtcgacgcgatcgcggacgccaagcgtcacggactggtc
cccgaagtggtgcacctgtccaattccgcggccaccctgacccgccccgacctgcggttt
gacatggttcgcccgggaatcgcgatatatgggttgtcgccagtacccgaactcgggcag
ttcgggttgcgaccggcgatgacactgcgatcgagggtggccctggtgaagaaggtggcg
gcaggtgaaggcgtgtcctacgggcatcagtgggtggcgccccgggacacgacggtggcg
ttgctgccgctggggtacgccgacgggctcccgcgttcgctgagcggccgattcgaggtc
cagctgggtgccgagcgacgtccggggatcgggcgtgtctgcatggaccaggtggtcgtc
gatctcggaccggacggcgggggagtccgggagggagacaccgcggtgttcttcggcaac
ggggacctcggcgagccgatcgcacaggaatgggccgacaagctcgacaccatccactac
gaggtggtgacgggggtgcgcggacgcacggtgcgcacctacgtcggtgggacgggcacg
tag

DBGET integrated database retrieval system