KEGG   Rhodococcus opacus B4: ROP_63260Help
Entry
ROP_63260         CDS       T00882                                 

Gene name
glpD
Definition
(GenBank) putative glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
rop  Rhodococcus opacus B4
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rop00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ROP_63260 (glpD)
Enzymes [BR:rop01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ROP_63260 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
6931251..6932993
Genome map
AA seq 580 aa AA seqDB search
MSSQPGVQFLGPRQRDAAWDELQTEQFDVVVIGGGVVGAGAALDAATRGLKVALVEARDY
ASGTSSRSSKMFHGGLRYLEQLEFGLVREALRERELSLTTLAPHLVKPLKFLFPITHRLW
ERPYMAAGIFLYDRMGGAKSVPPQKHLTRAGALRMAPGLKRNSLTGGIQYYDTVVDDARH
TMTVARTAAHYGAVVRTSTQVVGFLREADRVSGVRVRDCEDGRTADVKAHVVINATGVWT
DEIQALSRQRGRFRVRASKGVHIVVPRDRIVSDAAIILRTEKSVLFVIPWGSHWIIGTTD
TDWNLDLAHPAATKADIDYILGHVNKVLVTSLTHDDIDGVYAGLRPLLAGESDETSKLSR
EHAVARVAPGLVAIAGGKYTTYRVMAEDAVDLAAEDIPARMAPSITEKVPLVGADGYFAL
VNQTVHLGQLYGLHPYRVKHLLDRYGSLIGEVLDLAADKPELLQPLTDAPAYLQVEVVYA
AAAEGALHLDDILARRTRIAIEYSHRGVNCAEQVAQLVAPVLGWDADDIDREVKTYQARV
EAEVQSQAQPDDLSADALRAAAPESRIELLEPPVSVSEIP
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
ttgagtagtcagcctggtgtgcagttcctcggtccccggcagcgcgatgccgcctgggac
gagctgcagaccgaacagttcgacgtcgtcgtgatcggcggtggtgtggtcggggccggt
gcggccctggacgcggccacccgcgggctgaaggtggcgttggtggaggcgcgcgactac
gcgtccggaacgtcgagccgctcgtcgaagatgttccacggcgggctgcgctacctcgag
cagctcgagttcggactggtccgggaggcactccgggagcgtgagctgtcgctgaccacc
ctcgcgccgcacctggtgaagccgctcaagttcctgttcccgatcacccaccggttgtgg
gagcgcccctacatggcggccgggatcttcctctatgaccggatgggcggcgccaaatcg
gttccgccgcagaagcatctgacccgcgcgggtgcgctgcggatggcgccggggctcaag
cgcaactcgctgaccggtggcatccagtactacgacaccgtcgtcgacgacgcccggcac
accatgaccgttgctcgcaccgccgcccactacggggcggtcgtgcggacgtcgacgcag
gtggtcggattcctccgggaggcggaccgggtctccggagtgcgcgtccgggactgcgag
gacgggcgcaccgcggacgtcaaggcacacgtcgtcatcaacgcgaccggggtgtggacc
gacgagatccaggcgctgtcgcggcaacgcggccggtttcgcgtccgcgcgtccaagggc
gtccacatcgtggtgccccgcgaccggatcgtcagcgacgccgcgatcatcctccgcacc
gagaagtcggtgctgttcgtcattccgtggggcagccactggatcatcggcaccaccgac
acggactggaacctcgacctcgcgcacccggcggccaccaaggccgacatcgactacatc
ctcggccacgtcaacaaggtgctggtgacgtcgctgacccacgacgacatcgacggtgtg
tacgcgggtctgcgtccgctgctcgccggggagagcgacgagacgtccaagctgtcccgc
gagcacgccgtcgcgcgggtcgcgccgggcctcgtcgccatcgcgggcggcaagtacacc
acctaccgcgtgatggccgaggacgccgtggatctcgcggccgaggacattccggcgcgg
atggcgccgtccatcaccgagaaggtgccgctcgtgggtgcggacggctacttcgcgctg
gtcaaccagaccgtgcatctcggccagctgtacgggctgcacccgtaccgggtgaagcac
ctgctggaccgttacggctcgctgatcggcgaggtgctcgacctggcggccgacaagccg
gaactgctccagcccctcaccgacgcgcccgcctacctgcaggtcgaggtcgtgtacgcg
gcggcggccgagggtgcgctgcatctcgacgacatcctcgcccggcgcacccggatcgcg
atcgagtactcgcaccggggtgtgaactgcgccgagcaggtggcgcagctggtggctccg
gtcctcggctgggacgccgacgacatcgaccgcgaggtgaagacgtaccaggcgcgggtg
gaggcggaggtgcagtcgcaggcgcaaccggacgacctgtccgccgacgcgttgcgggcg
gcggcaccggaatcgcggatcgaactgctcgaaccgccggtcagtgtgtcagaaatacct
tga

DBGET integrated database retrieval system