KEGG   Raoultella ornithinolytica B6: RORB6_17635Help
Entry
RORB6_17635       CDS       T02625                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
ror  Raoultella ornithinolytica B6
Brite
Translation factors [BR:ror03012]
 Eukaryotic Type
  Elongation factors
   RORB6_17635
 Prokaryotic Type
   RORB6_17635
Mitochondrial biogenesis [BR:ror03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    RORB6_17635
Exosome [BR:ror04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RORB6_17635
  Exosomal proteins of breast cancer cells
   RORB6_17635
  Exosomal proteins of colorectal cancer cells
   RORB6_17635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(3881747..3882931)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GEADWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgactgctgcaatcactaccgttctggctaaaacctac
ggtggttctgctcgcgcattcgaccagatcgataacgcgccggaagagaaagctcgtggt
atcaccatcaacacttctcacgttgaatatgacaccccgactcgccactacgcacacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgctcagatggat
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggagctggttgaaatggaagtccgtgagctgctgtctcag
tacgacttcccgggcgacgacacgccgatcgttcgtggttccgctctgaaagcgctggaa
ggcgaagcagactgggaagcgaaaatcatcgaactggctggctacctggattcttacatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagtgggc
gaagaagttgaaatcgttggtatcaaagagactgcgaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggctctatcaag
ccgcacaccaagttcgaatctgaagtgtacattctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtacaactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtcatgccgggcgacaacatcaaaatggtt
gttaccctgattcacccgatcgcgatggacgatggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgtggtagcaaaagttctcggctaa

DBGET integrated database retrieval system