KEGG   Roseomonas sp. FDAARGOS_362: CTJ15_13855Help
Entry
CTJ15_13855       CDS       T05160                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ros  Roseomonas sp. FDAARGOS_362
Pathway
ros00500  Starch and sucrose metabolism
ros01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ros00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CTJ15_13855 (treS)
Enzymes [BR:ros01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CTJ15_13855 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     CTJ15_13855 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 DUF2856
Motif
Other DBs
NCBI-ProteinID: ATR21286
UniProt: A0A2D2H5H8
LinkDB All DBs
Position
1952597..1955851
Genome map
AA seq 1084 aa AA seqDB search
MSMTEDPHWYRDAVIYQLHIKSFFDSNNDGIGDFAGLIDKLDYLSELGVDTLWLLPFYPS
PRRDDGYDISEYRDVSPDYGTLDEAKRFIGEAHKRGLRVITELVINHTSDQHPWFQAARK
APPGDPARDYYVWSDNDELYSGTRIIFLDTEKSNWTWDEEAQSYFWHRFFSHQPDLNFDN
PRIMVEVLNIMRFWLDAGVDGLRLDAVPYLIERDGTSNENLPETHEVLKTLRRKLDEEYP
DRMLLAEANMWPEDTQQYFGEGDECHMAFHFPLMPRMYMAIAQEDRFPITDILRQTPDIP
DGCQWAIFLRNHDELTLEMVTDKERDYLWNTYAADKRARINLGIRRRLAPLLEHDRRRIE
LMNGLLMSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSKADPAGLVLP
TIQDPLYGFQAVNVEAQSRDAHSLLNWTRRMLATRKRSRAFGRGGMRLLYPGNRKVLAYV
REYGDESILCVFNLSRTSQAVELDLSAYVGRVPVEMLGGTAFPEIGQLTYLLTLQPFGFY
WFVLATEQALPPWHVKAPEPLPDLRTLVFPANTTGFGEAQKRELEREVLPSYLPKRRWFA
SKGEKLEGVSLKAIAPFPHARYVIFAEIEAKLPDRTERYCLPLAAVEDDDSASPLAYQLA
ISRVRQTRRVGYLTDAFASDDFVHAALVNFRRNSTTQSDEGEIRFIGGALLHGIEIPERP
EIRRLSAEQSNSSMIVGDQVVLKILRKLFSGIHPEAEMTRHLTEAGFQNIAPLLGEVVRT
GPDGQPVTLMLLQGFVRNQGDGWGWTLDWLARSVDEAALAHDGHEDIFAGYLSFATALGR
RLGELHAVLAAPSDDPAFTPEPAVEADRTAWAEGALEQLEPALKLLEKATDLSEADAARA
QSLLGKAQALRGKVHALAQAADGALKTRVHGDFHLGQVLVSQGDAVIVDFEGEPARSLEE
RRAKGSPLRDVAGLLRSFDYAAAAAAQSHDTGSSSAVPQERREALLARFRQEASDAFLAA
YRVVEHAAERPWVPEASEQSLLDLFLIEKAAYEIRYEAANRPAWLPLPLRGLAAIVERLI
PDAE
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgacggaagacccgcactggtaccgcgacgcggtcatctaccagttgcacatc
aagagcttcttcgattccaacaatgacgggatcggcgacttcgccggcctgatcgacaag
ctcgactacctctccgaactgggcgtggacacgctctggctgctgcccttctacccctcc
ccgcgccgcgacgacggctacgacatctcggagtatcgcgatgtcagccccgactacggc
acgctggacgaagccaagcgcttcatcggggaggcgcacaagcgcggcctgcgcgtcatc
accgagctggtgatcaaccacaccagcgaccagcacccctggttccaggccgcccgcaag
gcgcccccgggcgacccggcgcgcgactactacgtctggtcggacaatgacgagctctat
tccggcacccgcatcatcttcctcgacacggagaagtcgaactggacctgggacgaggag
gcccagtcctatttctggcaccgcttcttcagccaccagccggacctgaacttcgacaac
ccccgcatcatggtggaggtgctgaacatcatgcgcttctggctcgatgccggggtggat
ggcctgcgcctcgacgccgtgccctacctgatcgagcgcgacggcaccagcaacgagaac
ctgcccgagacgcacgaggtcctgaagacgctccgccgcaagctggacgaggaatacccc
gaccggatgctgctggccgaggccaacatgtggcccgaggacacgcagcagtatttcggg
gagggcgacgaatgccacatggccttccacttcccgctgatgccgcgcatgtacatggcg
atcgcgcaggaggaccgcttcccgatcaccgacatcctgcgccagacgcccgacatcccc
gatggctgccagtgggcgatcttcctgcgcaaccacgacgagctgacgctggagatggtc
acggacaaggaacgtgactacctctggaacacctatgccgccgacaagcgtgcccgcatc
aacctcggcatccgccgccgcctcgccccgctgctggaacacgaccgccgccgcatcgag
ctgatgaacggcctgctcatgtccatgcccggcacgccggtgatctactacggcgacgag
atcggcatgggcgacaacatctatctcggcgaccgcgacggcgtgcgcacgccgatgcag
tggtctcccgaccgcaacggcggcttcagcaaggccgacccggccggcctcgtcctgccc
accatccaggacccgctctacggcttccaggcggtgaacgtggaggcgcagtcgcgcgac
gcgcactccctgctgaactggacgcggcggatgctcgccacgcgcaagcgctcccgcgcc
ttcggccgcggcggcatgcgcctgctctacccgggcaaccgcaaggtccttgcctatgtc
cgggaatacggggacgagagcatcctctgcgtcttcaacctgtcccgcacctcccaggcg
gtggagctcgacctctccgcctatgtcggccgcgtgccggtggagatgctgggcggcacc
gccttcccggagatcggccagctcacctacctgctcaccctgcagcccttcggcttctac
tggttcgtgctggcgaccgagcaggccctcccaccctggcacgtgaaggcgcccgagccc
ttgcccgacctgcgcaccctggtcttcccggccaacaccaccggcttcggcgaggcgcag
aagcgcgagctggagcgcgaggtgctgcccagctacctgcccaagcgccgctggttcgcc
tccaagggcgagaagctcgaaggtgtcagcctgaaggccatcgcccccttcccgcacgcc
cgctacgtcatcttcgccgagatcgaggcgaagctgcccgaccgcaccgagcgctactgc
ctgcccctggccgcggtggaggacgacgacagcgccagcccgctggcctatcagctcgcc
atctcccgcgtgcggcagacgcgccgcgtcggctacctgaccgatgccttcgcctccgac
gacttcgtgcatgccgcgctggtgaacttccgccgcaacagcaccacgcagagcgacgag
ggcgagatccgcttcatcggcggcgccctgctgcacggcatcgagatccccgagcggccg
gagatccgccggctttccgcggaacagtccaactcctcgatgatcgtcggcgaccaggtg
gtgctgaagatcctgcgcaagctcttctccggcatccatccggaggccgagatgacgcgc
catctcaccgaggccggcttccagaacatcgccccgctgctgggcgaggtggtccgcacc
gggccggacggacagccggtgacgctgatgctgctgcagggcttcgtccgcaaccagggc
gacggctggggctggaccctggactggctggcccgctcggtggacgaggccgcgctggcc
catgacgggcacgaggacatcttcgccggctacctcagcttcgccaccgccctgggccgc
cgcctgggcgagttgcacgccgtgctcgccgcaccgtccgacgacccggccttcacgccc
gaacccgccgtggaggcggaccgcacggcctgggccgagggcgcgctggaacagctcgaa
ccggcgctcaagctgctggaaaaggccaccgacctgtcggaggcggacgcggcccgcgcg
cagtccctgctcggcaaggcccaggccctgcgcggcaaggtccacgcgctggcgcaagcc
gccgacggcgcgctcaagacccgcgtgcatggcgacttccacctgggccaggtcctggtc
tcccagggcgacgccgtgatcgtggacttcgagggcgagcccgcgcgctcgctggaggaa
cgccgcgccaagggctcgccgctgcgcgacgtggccgggctgctgcgttccttcgactac
gccgccgccgccgccgcccagagccacgacacgggcagcagctccgccgtgccgcaggaa
cgccgcgaggcgctcctggcacgcttccgccaggaggcctccgacgccttcctggcggcc
taccgcgtcgtggagcacgcggcggaacgcccctgggtgccggaggcctccgaacagtcc
ctgctcgatctcttcctgatcgagaaggctgcctacgagatccgctacgaggcggccaac
cggcccgcctggcttcccctccccctgcgcggcctggccgccatcgtcgagaggctgatc
cccgatgcggaatga

DBGET integrated database retrieval system