KEGG   Rhodopseudomonas palustris CGA009: RPA3880Help
Entry
RPA3880           CDS       T00153                                 

Definition
(GenBank) possible glutathione S-transferase P subunit
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
rpa  Rhodopseudomonas palustris CGA009
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rpa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    RPA3880
Enzymes [BR:rpa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RPA3880
Transporters [BR:rpa02000]
 Other Transporters
  Pores ion channels [TC:1]
   RPA3880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
CyanoBase: 
CYORF: 
UniProt: 
LinkDB All DBs
Position
complement(4379688..4380398)
Genome map
AA seq 236 aa AA seqDB search
MSYELYYWPTIQGRGEFVRLALEEAGADYVDAARRNKAGMSTMMKLMQAEQGTPPFAPPF
LKAGKLIISQTANILLYLGSRHRLAPASEAGRLWVHQLQLTIADLVQEVHDTHHPIGTML
YYEDQRKPAKKRTAEFWDNRAPKFLGYFERLIAGGGGAYLTGRKPTYADLSLFQIVEGLR
YAFPKHMKKFERDIPKLVALHDRVAERPNIAAYLASDRRIPFNQEGIFRHYKELDK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgaactgtactactggccgaccattcagggccgcggcgaattcgtgcggctg
gcgctggaagaggccggcgccgactatgtcgatgccgcgcgccgcaacaaggccggcatg
tcgacgatgatgaaactgatgcaggcggaacaaggcacgccgccgttcgcgccgccgttt
ctcaaagccggcaagctgatcatcagccagaccgccaacatcctgctgtatctcggcagt
cgccatcgccttgcgcccgccagcgaagccggccggctgtgggtgcatcagctgcagctc
acgatcgcggacctggtgcaggaggtgcacgacactcaccatccgatcggcaccatgctg
tactacgaagaccagcggaagccggcgaaaaagcgcaccgccgagttctgggacaatcgt
gcgccgaaattcctcggctatttcgaacggctgatcgccggcggtggcggcgcttatctg
accgggcgcaagccgacctatgcggacctgtcgctgtttcagatcgtcgagggcctgcgc
tacgcgtttccgaagcacatgaaaaagttcgagcgcgacattcccaagctggtcgcgctg
cacgaccgcgtcgccgaacgcccgaacatcgccgcctatctggccagcgaccgccgcatc
ccgttcaaccaagaaggcatcttccggcactacaaggagctggataagtaa

DBGET integrated database retrieval system